Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
Location | 2890413..2891127 | Replicon | chromosome |
Accession | NZ_CP096846 | ||
Organism | Mycobacterium tuberculosis variant bovis strain Mb2377 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | G0TQK0 |
Locus tag | M1775_RS13535 | Protein ID | WP_003413460.1 |
Coordinates | 2890687..2891127 (+) | Length | 147 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | P9WJ20 |
Locus tag | M1775_RS13530 | Protein ID | WP_003413456.1 |
Coordinates | 2890413..2890700 (+) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M1775_RS13495 (M1775_13490) | 2885835..2886080 | + | 246 | WP_003413429.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | - |
M1775_RS13500 (M1775_13495) | 2886077..2886481 | + | 405 | WP_003413432.1 | type II toxin-antitoxin system VapC family toxin | - |
M1775_RS13505 (M1775_13500) | 2886698..2887318 | + | 621 | WP_003413441.1 | DUF4178 domain-containing protein | - |
M1775_RS13510 (M1775_13505) | 2887329..2887823 | + | 495 | WP_003413444.1 | DUF2617 family protein | - |
M1775_RS13515 (M1775_13510) | 2887820..2888251 | + | 432 | WP_003413445.1 | DUF4247 domain-containing protein | - |
M1775_RS13520 (M1775_13515) | 2888276..2888734 | + | 459 | WP_003413451.1 | DUF350 domain-containing protein | - |
M1775_RS13525 (M1775_13520) | 2888731..2890302 | + | 1572 | WP_003899392.1 | polyamine aminopropyltransferase | - |
M1775_RS13530 (M1775_13525) | 2890413..2890700 | + | 288 | WP_003413456.1 | antitoxin VapB41 | Antitoxin |
M1775_RS13535 (M1775_13530) | 2890687..2891127 | + | 441 | WP_003413460.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
M1775_RS13540 (M1775_13535) | 2891148..2891903 | - | 756 | WP_003413464.1 | YebC/PmpR family DNA-binding transcriptional regulator | - |
M1775_RS13545 (M1775_13540) | 2892036..2892632 | - | 597 | WP_003413465.1 | pyridoxal 5'-phosphate synthase glutaminase subunit PdxT | - |
M1775_RS13550 (M1775_13545) | 2892640..2893485 | - | 846 | WP_010950749.1 | acyl-CoA thioesterase II | - |
M1775_RS13555 (M1775_13550) | 2893514..2894413 | - | 900 | WP_003413468.1 | pyridoxal 5'-phosphate synthase lyase subunit PdxS | - |
M1775_RS13560 (M1775_13555) | 2894541..2895215 | + | 675 | WP_003413471.1 | pyridoxamine 5'-phosphate oxidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 147 a.a. Molecular weight: 16026.38 Da Isoelectric Point: 6.8599
>T243949 WP_003413460.1 NZ_CP096846:2890687-2891127 [Mycobacterium tuberculosis variant bovis]
MLLCDTNIWLALALSGHVHHRASRAWLDTINAPGVIHFCRATQQSLLRLLTNRTVLGAYGSPPLTNREAWAAYAAFLDDD
RIVLAGAEPDGLEAQWRAFAVRQSPAPKVWMDAYLAAFALTGGFELVTTDTAFTQYGGIELRLLAK
MLLCDTNIWLALALSGHVHHRASRAWLDTINAPGVIHFCRATQQSLLRLLTNRTVLGAYGSPPLTNREAWAAYAAFLDDD
RIVLAGAEPDGLEAQWRAFAVRQSPAPKVWMDAYLAAFALTGGFELVTTDTAFTQYGGIELRLLAK
Download Length: 441 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | G0TQK0 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U4BWB8 |