Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
| Location | 2828967..2829598 | Replicon | chromosome |
| Accession | NZ_CP096846 | ||
| Organism | Mycobacterium tuberculosis variant bovis strain Mb2377 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | G0TQ28 |
| Locus tag | M1775_RS13260 | Protein ID | WP_003413174.1 |
| Coordinates | 2829221..2829598 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | P95006 |
| Locus tag | M1775_RS13255 | Protein ID | WP_003413167.1 |
| Coordinates | 2828967..2829224 (+) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M1775_RS13220 (M1775_13215) | 2824225..2824539 | + | 315 | WP_009937839.1 | hypothetical protein | - |
| M1775_RS13225 (M1775_13220) | 2824835..2826046 | + | 1212 | WP_003900845.1 | alpha/beta hydrolase family protein | - |
| M1775_RS13230 (M1775_13225) | 2826173..2826832 | + | 660 | WP_003900846.1 | LppA family lipoprotein | - |
| M1775_RS13235 (M1775_13230) | 2826829..2827488 | + | 660 | WP_003900847.1 | LppA family lipoprotein | - |
| M1775_RS13240 (M1775_13235) | 2827485..2828147 | + | 663 | WP_003900848.1 | LppA family lipoprotein | - |
| M1775_RS13245 (M1775_13240) | 2828144..2828422 | + | 279 | WP_003901422.1 | type II toxin-antitoxin system VapB family antitoxin | - |
| M1775_RS13250 (M1775_13245) | 2828515..2828928 | + | 414 | WP_003413164.1 | PIN domain nuclease | - |
| M1775_RS13255 (M1775_13250) | 2828967..2829224 | + | 258 | WP_003413167.1 | CopG family transcriptional regulator | Antitoxin |
| M1775_RS13260 (M1775_13255) | 2829221..2829598 | + | 378 | WP_003413174.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| M1775_RS13265 (M1775_13260) | 2829614..2829988 | - | 375 | WP_003413177.1 | hypothetical protein | - |
| M1775_RS13270 (M1775_13265) | 2830088..2830483 | - | 396 | WP_003413180.1 | type II toxin-antitoxin system toxin 23S rRNA-specific endonuclease VapC20 | - |
| M1775_RS13275 (M1775_13270) | 2830480..2830725 | - | 246 | WP_003413183.1 | type II toxin-antitoxin system antitoxin VapB20 | - |
| M1775_RS13280 (M1775_13275) | 2831136..2831555 | - | 420 | WP_003413190.1 | A24 family peptidase | - |
| M1775_RS13285 (M1775_13280) | 2831567..2832374 | - | 808 | Protein_2622 | shikimate dehydrogenase | - |
| M1775_RS13290 (M1775_13285) | 2832371..2833624 | - | 1254 | WP_003413196.1 | endolytic transglycosylase MltG | - |
| M1775_RS13295 (M1775_13290) | 2833617..2834129 | - | 513 | WP_003413197.1 | Holliday junction resolvase RuvX | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13728.72 Da Isoelectric Point: 4.4687
>T243947 WP_003413174.1 NZ_CP096846:2829221-2829598 [Mycobacterium tuberculosis variant bovis]
VKLIDTTIAVDHLRGEPAAAVLLAELINNGEEIAASELVRFELLAGVRESELAALEAFFSAVVWTLVTEDIARIGGRLAR
RYRSSHRGIDDVDYLIAATAIVVDADLLTTNVRHFPMFPDLQPPY
VKLIDTTIAVDHLRGEPAAAVLLAELINNGEEIAASELVRFELLAGVRESELAALEAFFSAVVWTLVTEDIARIGGRLAR
RYRSSHRGIDDVDYLIAATAIVVDADLLTTNVRHFPMFPDLQPPY
Download Length: 378 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | G0TQ28 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829C9W5 |