243947

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/LOTUS_5_Limkain_b1(toxin)
Location 2828967..2829598 Replicon chromosome
Accession NZ_CP096846
Organism Mycobacterium tuberculosis variant bovis strain Mb2377

Toxin (Protein)


Gene name vapC Uniprot ID G0TQ28
Locus tag M1775_RS13260 Protein ID WP_003413174.1
Coordinates 2829221..2829598 (+) Length 126 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID P95006
Locus tag M1775_RS13255 Protein ID WP_003413167.1
Coordinates 2828967..2829224 (+) Length 86 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M1775_RS13220 (M1775_13215) 2824225..2824539 + 315 WP_009937839.1 hypothetical protein -
M1775_RS13225 (M1775_13220) 2824835..2826046 + 1212 WP_003900845.1 alpha/beta hydrolase family protein -
M1775_RS13230 (M1775_13225) 2826173..2826832 + 660 WP_003900846.1 LppA family lipoprotein -
M1775_RS13235 (M1775_13230) 2826829..2827488 + 660 WP_003900847.1 LppA family lipoprotein -
M1775_RS13240 (M1775_13235) 2827485..2828147 + 663 WP_003900848.1 LppA family lipoprotein -
M1775_RS13245 (M1775_13240) 2828144..2828422 + 279 WP_003901422.1 type II toxin-antitoxin system VapB family antitoxin -
M1775_RS13250 (M1775_13245) 2828515..2828928 + 414 WP_003413164.1 PIN domain nuclease -
M1775_RS13255 (M1775_13250) 2828967..2829224 + 258 WP_003413167.1 CopG family transcriptional regulator Antitoxin
M1775_RS13260 (M1775_13255) 2829221..2829598 + 378 WP_003413174.1 type II toxin-antitoxin system VapC family toxin Toxin
M1775_RS13265 (M1775_13260) 2829614..2829988 - 375 WP_003413177.1 hypothetical protein -
M1775_RS13270 (M1775_13265) 2830088..2830483 - 396 WP_003413180.1 type II toxin-antitoxin system toxin 23S rRNA-specific endonuclease VapC20 -
M1775_RS13275 (M1775_13270) 2830480..2830725 - 246 WP_003413183.1 type II toxin-antitoxin system antitoxin VapB20 -
M1775_RS13280 (M1775_13275) 2831136..2831555 - 420 WP_003413190.1 A24 family peptidase -
M1775_RS13285 (M1775_13280) 2831567..2832374 - 808 Protein_2622 shikimate dehydrogenase -
M1775_RS13290 (M1775_13285) 2832371..2833624 - 1254 WP_003413196.1 endolytic transglycosylase MltG -
M1775_RS13295 (M1775_13290) 2833617..2834129 - 513 WP_003413197.1 Holliday junction resolvase RuvX -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(3-111)

Antitoxin

Ribbon-helix-helix protein, CopG

(2-38)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 13728.72 Da        Isoelectric Point: 4.4687

>T243947 WP_003413174.1 NZ_CP096846:2829221-2829598 [Mycobacterium tuberculosis variant bovis]
VKLIDTTIAVDHLRGEPAAAVLLAELINNGEEIAASELVRFELLAGVRESELAALEAFFSAVVWTLVTEDIARIGGRLAR
RYRSSHRGIDDVDYLIAATAIVVDADLLTTNVRHFPMFPDLQPPY

Download         Length: 378 bp

Antitoxin


Download         Length: 86 a.a.        Molecular weight: 9453.63 Da        Isoelectric Point: 10.6555

>AT243947 WP_003413167.1 NZ_CP096846:2828967-2829224 [Mycobacterium tuberculosis variant bovis]
MRTQVTLGKEELELLDRAAKASGASRSELIRRAIHRAYGTGSKQERLAALDHSRGSWRGRDFTGTEYVDAIRGDLNERLA
RLGLA

Download         Length: 258 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G0TQ28

Antitoxin

Source ID Structure
AlphaFold DB A0A829C9W5

References