Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/PIN(toxin)
Location 2813972..2814612 Replicon chromosome
Accession NZ_CP096846
Organism Mycobacterium tuberculosis variant bovis strain Mb2377

Toxin (Protein)


Gene name vapC Uniprot ID G0TQ08
Locus tag M1775_RS13160 Protein ID WP_003412970.1
Coordinates 2813972..2814391 (-) Length 140 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID G0TQ09
Locus tag M1775_RS13165 Protein ID WP_003412975.1
Coordinates 2814388..2814612 (-) Length 75 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M1775_RS13130 (M1775_13125) 2809557..2810279 - 723 WP_003412957.1 DUF1906 domain-containing protein -
M1775_RS13135 (M1775_13130) 2810796..2811023 + 228 WP_003412960.1 type II toxin-antitoxin system VapB family antitoxin -
M1775_RS13140 (M1775_13135) 2811020..2811421 + 402 WP_003412963.1 PIN domain-containing protein -
M1775_RS13145 (M1775_13140) 2811456..2812376 - 921 WP_011799273.1 restriction endonuclease -
M1775_RS13150 (M1775_13145) 2812717..2812923 - 207 WP_229298035.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein -
M1775_RS13155 (M1775_13150) 2813021..2813971 + 951 WP_003911916.1 ERCC4 domain-containing protein -
M1775_RS13160 (M1775_13155) 2813972..2814391 - 420 WP_003412970.1 type II toxin-antitoxin system VapC family toxin Toxin
M1775_RS13165 (M1775_13160) 2814388..2814612 - 225 WP_003412975.1 antitoxin VapB39 Antitoxin
M1775_RS13170 (M1775_13165) 2814643..2817486 - 2844 WP_003899363.1 aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme -
M1775_RS13175 (M1775_13170) 2817558..2817959 - 402 WP_003412981.1 hypothetical protein -
M1775_RS13180 (M1775_13175) 2817959..2818429 - 471 WP_003412985.1 transcription antitermination factor NusB -
M1775_RS13185 (M1775_13180) 2818432..2818995 - 564 WP_003412989.1 elongation factor P -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(4-128)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 140 a.a.        Molecular weight: 14732.70 Da        Isoelectric Point: 6.7519

>T243945 WP_003412970.1 NZ_CP096846:c2814391-2813972 [Mycobacterium tuberculosis variant bovis]
VTALLDVNVLIALGWPNHVHHAAAQRWFTQFSSNGWATTPITEAGYVRISSNRSVMQVSTTPAIAIAQLAAMTSLAGHTF
WPDDVPLIVGSAGDRDAVSNHRRVTDCHLIALAARYGGRLVTFDAALADSASAGLVEVL

Download         Length: 420 bp

Antitoxin


Download         Length: 75 a.a.        Molecular weight: 7993.94 Da        Isoelectric Point: 4.0057

>AT243945 WP_003412975.1 NZ_CP096846:c2814612-2814388 [Mycobacterium tuberculosis variant bovis]
MRTTLQIDDDVLEDARSIARSEGKSVGAVISELARRSLRPVGIVEVDGFPVFDVPPDAPTVTSEDVVRALEDDV

Download         Length: 225 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G0TQ08

Antitoxin

Source ID Structure
AlphaFold DB G0TQ09

References