243943

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/-
Location 2378155..2378684 Replicon chromosome
Accession NZ_CP096846
Organism Mycobacterium tuberculosis variant bovis strain Mb2377

Toxin (Protein)


Gene name parE Uniprot ID G0TMR4
Locus tag M1775_RS11115 Protein ID WP_003411124.1
Coordinates 2378155..2378472 (-) Length 106 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID P9WJ74
Locus tag M1775_RS11120 Protein ID WP_003411127.1
Coordinates 2378469..2378684 (-) Length 72 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M1775_RS11085 (M1775_11090) 2373176..2374252 + 1077 WP_003411110.1 hypothetical protein -
M1775_RS11090 (M1775_11095) 2374249..2374530 + 282 WP_019283661.1 DUF5703 family protein -
M1775_RS11095 (M1775_11100) 2374566..2375639 + 1074 WP_011799246.1 quinone-dependent dihydroorotate dehydrogenase -
M1775_RS11100 (M1775_11105) 2375644..2376174 - 531 WP_003411119.1 YbhB/YbcL family Raf kinase inhibitor-like protein -
M1775_RS11105 (M1775_11110) 2376222..2377568 - 1347 WP_003411121.1 M20/M25/M40 family metallo-hydrolase -
M1775_RS11115 (M1775_11120) 2378155..2378472 - 318 WP_003411124.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
M1775_RS11120 (M1775_11125) 2378469..2378684 - 216 WP_003411127.1 antitoxin ParD2 Antitoxin
M1775_RS11125 (M1775_11130) 2378939..2379997 + 1059 WP_003411129.1 phosphoribosyltransferase family protein -
M1775_RS11130 (M1775_11135) 2380127..2380483 - 357 WP_003411130.1 hypothetical protein -
M1775_RS11135 (M1775_11140) 2380578..2381360 - 783 WP_003411131.1 cell wall synthesis protein Wag31 -
M1775_RS11140 (M1775_11145) 2381628..2381918 - 291 WP_003900476.1 YggT family protein -
M1775_RS11145 (M1775_11150) 2382080..2382736 - 657 WP_003411133.1 cell division protein SepF -
M1775_RS11150 (M1775_11155) 2382802..2383578 - 777 WP_003411137.1 YggS family pyridoxal phosphate-dependent enzyme -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-92)

Antitoxin

Conserved hypothetical protein CHP02574, addiction module

(11-69)


Sequences

Toxin        


Download         Length: 106 a.a.        Molecular weight: 12312.88 Da        Isoelectric Point: 6.4831

>T243943 WP_003411124.1 NZ_CP096846:c2378472-2378155 [Mycobacterium tuberculosis variant bovis]
MTRRLRVHNGVEDDLFEAFSYYADAAPDQIDRLYNLFVDAVTKRIPQAPNAFAPLFKHYRHIYLRPFRYYVAYRTTDEAI
DILAVRHGMENPNAVEAEISGRTFE

Download         Length: 318 bp

Antitoxin


Download         Length: 72 a.a.        Molecular weight: 7880.70 Da        Isoelectric Point: 4.4055

>AT243943 WP_003411127.1 NZ_CP096846:c2378684-2378469 [Mycobacterium tuberculosis variant bovis]
VVVNRALLASVDALSRDEQIELVEHINGNLAEGMHISEANQALIEARANDTDDAHWSTIDDFDKRIRARLG

Download         Length: 216 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G0TMR4

Antitoxin

Source ID Structure
AlphaFold DB A0A7U4FAJ4

References