Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | parDE/- |
| Location | 2378155..2378684 | Replicon | chromosome |
| Accession | NZ_CP096846 | ||
| Organism | Mycobacterium tuberculosis variant bovis strain Mb2377 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | G0TMR4 |
| Locus tag | M1775_RS11115 | Protein ID | WP_003411124.1 |
| Coordinates | 2378155..2378472 (-) | Length | 106 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | P9WJ74 |
| Locus tag | M1775_RS11120 | Protein ID | WP_003411127.1 |
| Coordinates | 2378469..2378684 (-) | Length | 72 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M1775_RS11085 (M1775_11090) | 2373176..2374252 | + | 1077 | WP_003411110.1 | hypothetical protein | - |
| M1775_RS11090 (M1775_11095) | 2374249..2374530 | + | 282 | WP_019283661.1 | DUF5703 family protein | - |
| M1775_RS11095 (M1775_11100) | 2374566..2375639 | + | 1074 | WP_011799246.1 | quinone-dependent dihydroorotate dehydrogenase | - |
| M1775_RS11100 (M1775_11105) | 2375644..2376174 | - | 531 | WP_003411119.1 | YbhB/YbcL family Raf kinase inhibitor-like protein | - |
| M1775_RS11105 (M1775_11110) | 2376222..2377568 | - | 1347 | WP_003411121.1 | M20/M25/M40 family metallo-hydrolase | - |
| M1775_RS11115 (M1775_11120) | 2378155..2378472 | - | 318 | WP_003411124.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| M1775_RS11120 (M1775_11125) | 2378469..2378684 | - | 216 | WP_003411127.1 | antitoxin ParD2 | Antitoxin |
| M1775_RS11125 (M1775_11130) | 2378939..2379997 | + | 1059 | WP_003411129.1 | phosphoribosyltransferase family protein | - |
| M1775_RS11130 (M1775_11135) | 2380127..2380483 | - | 357 | WP_003411130.1 | hypothetical protein | - |
| M1775_RS11135 (M1775_11140) | 2380578..2381360 | - | 783 | WP_003411131.1 | cell wall synthesis protein Wag31 | - |
| M1775_RS11140 (M1775_11145) | 2381628..2381918 | - | 291 | WP_003900476.1 | YggT family protein | - |
| M1775_RS11145 (M1775_11150) | 2382080..2382736 | - | 657 | WP_003411133.1 | cell division protein SepF | - |
| M1775_RS11150 (M1775_11155) | 2382802..2383578 | - | 777 | WP_003411137.1 | YggS family pyridoxal phosphate-dependent enzyme | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12312.88 Da Isoelectric Point: 6.4831
>T243943 WP_003411124.1 NZ_CP096846:c2378472-2378155 [Mycobacterium tuberculosis variant bovis]
MTRRLRVHNGVEDDLFEAFSYYADAAPDQIDRLYNLFVDAVTKRIPQAPNAFAPLFKHYRHIYLRPFRYYVAYRTTDEAI
DILAVRHGMENPNAVEAEISGRTFE
MTRRLRVHNGVEDDLFEAFSYYADAAPDQIDRLYNLFVDAVTKRIPQAPNAFAPLFKHYRHIYLRPFRYYVAYRTTDEAI
DILAVRHGMENPNAVEAEISGRTFE
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | G0TMR4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U4FAJ4 |