Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VapB |
Location | 2232491..2233117 | Replicon | chromosome |
Accession | NZ_CP096846 | ||
Organism | Mycobacterium tuberculosis variant bovis strain Mb2377 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | P64926 |
Locus tag | M1775_RS10440 | Protein ID | WP_003410075.1 |
Coordinates | 2232719..2233117 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | M1775_RS10435 | Protein ID | WP_019283586.1 |
Coordinates | 2232491..2232718 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M1775_RS10425 (M1775_10430) | 2230530..2230874 | - | 345 | WP_003410065.1 | ferredoxin family protein | - |
M1775_RS10430 (M1775_10435) | 2231063..2232232 | - | 1170 | WP_003899126.1 | ATP-binding protein | - |
M1775_RS10435 (M1775_10440) | 2232491..2232718 | + | 228 | WP_019283586.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
M1775_RS10440 (M1775_10445) | 2232719..2233117 | + | 399 | WP_003410075.1 | PIN domain nuclease | Toxin |
M1775_RS10445 (M1775_10450) | 2233300..2233731 | - | 432 | WP_003410078.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
M1775_RS10450 (M1775_10455) | 2233880..2234266 | + | 387 | WP_003899128.1 | DUF1398 domain-containing protein | - |
M1775_RS10455 (M1775_10460) | 2234703..2234882 | - | 180 | Protein_2066 | hypothetical protein | - |
M1775_RS10460 (M1775_10465) | 2234970..2236133 | + | 1164 | WP_242302829.1 | IS110 family transposase | - |
M1775_RS10465 (M1775_10470) | 2236261..2237517 | - | 1257 | WP_003410095.1 | HNH endonuclease signature motif containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14731.02 Da Isoelectric Point: 6.7067
>T243939 WP_003410075.1 NZ_CP096846:2232719-2233117 [Mycobacterium tuberculosis variant bovis]
MIVDTSVWIAYLSTSESLASRWLADRIAADSTVIVPEVVMMELLIGKTDEDTAALRRRLLQRFAIEPLAPVRDAEDAAAI
HRRCRRGGDTVRSLIDCQVAAMALRIGVAVAHRDRDYEAIRTHCGLRTEPLF
MIVDTSVWIAYLSTSESLASRWLADRIAADSTVIVPEVVMMELLIGKTDEDTAALRRRLLQRFAIEPLAPVRDAEDAAAI
HRRCRRGGDTVRSLIDCQVAAMALRIGVAVAHRDRDYEAIRTHCGLRTEPLF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|