Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC(toxin) |
Location | 2199858..2200546 | Replicon | chromosome |
Accession | NZ_CP096846 | ||
Organism | Mycobacterium tuberculosis variant bovis strain Mb2377 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | P0A653 |
Locus tag | M1775_RS10270 | Protein ID | WP_003409958.1 |
Coordinates | 2199858..2200277 (-) | Length | 140 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | P9WJ28 |
Locus tag | M1775_RS10275 | Protein ID | WP_003409968.1 |
Coordinates | 2200286..2200546 (-) | Length | 87 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M1775_RS10240 (M1775_10245) | 2194864..2195169 | + | 306 | Protein_2023 | ABC transporter permease | - |
M1775_RS10245 (M1775_10250) | 2195165..2195245 | + | 81 | Protein_2024 | hypothetical protein | - |
M1775_RS10250 (M1775_10255) | 2195353..2196201 | + | 849 | WP_003409942.1 | class I SAM-dependent methyltransferase | - |
M1775_RS10255 (M1775_10260) | 2196164..2197609 | - | 1446 | WP_003409946.1 | APC family permease | - |
M1775_RS10260 (M1775_10265) | 2197788..2198474 | - | 687 | WP_003409954.1 | immunoprotective protein Mpt64 | - |
M1775_RS10265 (M1775_10270) | 2198665..2199633 | - | 969 | WP_003409956.1 | class 1b ribonucleoside-diphosphate reductase subunit beta | - |
M1775_RS10270 (M1775_10275) | 2199858..2200277 | - | 420 | WP_003409958.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
M1775_RS10275 (M1775_10280) | 2200286..2200546 | - | 261 | WP_003409968.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
M1775_RS10280 (M1775_10285) | 2200689..2202365 | + | 1677 | WP_010950639.1 | PecA family PE domain-processing aspartic protease | - |
M1775_RS10285 (M1775_10290) | 2202353..2203006 | - | 654 | WP_003409976.1 | cutinase Cfp21 | - |
M1775_RS10290 (M1775_10295) | 2203121..2203351 | + | 231 | WP_003409980.1 | DUF167 domain-containing protein | - |
M1775_RS10295 (M1775_10300) | 2203436..2204347 | - | 912 | WP_003409986.1 | ArgP/LysG family DNA-binding transcriptional regulator | - |
M1775_RS10300 (M1775_10305) | 2204456..2205055 | + | 600 | WP_003409989.1 | L-lysine exporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 14724.89 Da Isoelectric Point: 7.9535
>T243936 WP_003409958.1 NZ_CP096846:c2200277-2199858 [Mycobacterium tuberculosis variant bovis]
MIVDTSAVVALVQGERPHATLVAAALAGAHSPVMSAPTVAECLIVLTARHGPVARTIFERLRSEIGLSVSSFTAEHAAAT
QRAFLRYGKGRHRAALNFGDCMTYATAQLGHQPLLAVGNDFPQTDLEFRGVVGYWPGVA
MIVDTSAVVALVQGERPHATLVAAALAGAHSPVMSAPTVAECLIVLTARHGPVARTIFERLRSEIGLSVSSFTAEHAAAT
QRAFLRYGKGRHRAALNFGDCMTYATAQLGHQPLLAVGNDFPQTDLEFRGVVGYWPGVA
Download Length: 420 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829C4H9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829C483 |