243935

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/ParE-RHH
Location 2190845..2191389 Replicon chromosome
Accession NZ_CP096846
Organism Mycobacterium tuberculosis variant bovis strain Mb2377

Toxin (Protein)


Gene name parE Uniprot ID G0TLU9
Locus tag M1775_RS10210 Protein ID WP_003409896.1
Coordinates 2190845..2191141 (-) Length 99 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID P67299
Locus tag M1775_RS10215 Protein ID WP_003409899.1
Coordinates 2191138..2191389 (-) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M1775_RS10155 (M1775_10160) 2185878..2186228 - 351 WP_003409871.1 hypothetical protein -
M1775_RS10160 (M1775_10165) 2186239..2187141 - 903 WP_003409874.1 hypothetical protein -
M1775_RS10165 (M1775_10170) 2187162..2187353 - 192 WP_003409876.1 hypothetical protein -
M1775_RS10170 (M1775_10175) 2187354..2187650 - 297 WP_003409877.1 hypothetical protein -
M1775_RS10175 (M1775_10180) 2187890..2188105 + 216 WP_003409878.1 antitoxin -
M1775_RS10180 (M1775_10185) 2188102..2188413 + 312 WP_003409881.1 type II toxin-antitoxin system VapC family toxin -
M1775_RS10185 (M1775_10190) 2188387..2188908 - 522 WP_010950637.1 hypothetical protein -
M1775_RS10190 (M1775_10195) 2188883..2189260 + 378 WP_010886136.1 type II toxin-antitoxin system toxin HigB -
M1775_RS10195 (M1775_10200) 2189302..2189751 + 450 WP_003409886.1 type II toxin-antitoxin system antitoxin HigA -
M1775_RS10200 (M1775_10205) 2189748..2190293 + 546 WP_003409891.1 SecB-like chaperone -
M1775_RS10205 (M1775_10210) 2190182..2190796 - 615 WP_003901296.1 hypothetical protein -
M1775_RS10210 (M1775_10215) 2190845..2191141 - 297 WP_003409896.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
M1775_RS10215 (M1775_10220) 2191138..2191389 - 252 WP_003409899.1 type II toxin-antitoxin system ParD family antitoxin Antitoxin
M1775_RS10220 (M1775_10225) 2191376..2191870 + 495 WP_003899099.1 hypothetical protein -
M1775_RS10225 (M1775_10230) 2192030..2192437 - 408 WP_003409913.1 type II toxin-antitoxin system VapC family toxin -
M1775_RS10230 (M1775_10235) 2192441..2192713 - 273 WP_003899100.1 type II toxin-antitoxin system Phd/YefM family antitoxin -
M1775_RS10235 (M1775_10240) 2192746..2193966 - 1221 WP_003409919.1 TetR family transcriptional regulator Mce3R -
M1775_RS10240 (M1775_10245) 2194864..2195169 + 306 Protein_2023 ABC transporter permease -
M1775_RS10245 (M1775_10250) 2195165..2195245 + 81 Protein_2024 hypothetical protein -
M1775_RS10250 (M1775_10255) 2195353..2196201 + 849 WP_003409942.1 class I SAM-dependent methyltransferase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-93)

Antitoxin

Antitoxin ParD

(2-80)


Sequences

Toxin        


Download         Length: 99 a.a.        Molecular weight: 11268.64 Da        Isoelectric Point: 6.8604

>T243935 WP_003409896.1 NZ_CP096846:c2191141-2190845 [Mycobacterium tuberculosis variant bovis]
VSSRYLLSPAAQAHLEEIWDCTYDRWGVDQAEQYLRELQHAIDRAAANPRIGRACDEIRPGYRKLSAGSHTLFYRVTGEG
TIDVVRVLHQRMDVDRNL

Download         Length: 297 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9207.17 Da        Isoelectric Point: 7.0150

>AT243935 WP_003409899.1 NZ_CP096846:c2191389-2191138 [Mycobacterium tuberculosis variant bovis]
VGKNTSFVLDEHYSAFIDGEIAAGRYRSASEVIRSALRLLEDRETQLRALREALEAGERSGSSTPFDFDGFLGRKRADAS
RGR

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G0TLU9

Antitoxin

Source ID Structure
AlphaFold DB A0A7U4BUZ2

References