Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 2181808..2182511 | Replicon | chromosome |
| Accession | NZ_CP096846 | ||
| Organism | Mycobacterium tuberculosis variant bovis strain Mb2377 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | G0TLK7 |
| Locus tag | M1775_RS10120 | Protein ID | WP_003409778.1 |
| Coordinates | 2181808..2182137 (-) | Length | 110 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | G0TLK8 |
| Locus tag | M1775_RS10125 | Protein ID | WP_003409780.1 |
| Coordinates | 2182134..2182511 (-) | Length | 126 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M1775_RS10100 (M1775_10105) | 2178191..2179261 | + | 1071 | WP_003899091.1 | epoxide hydrolase EphB | - |
| M1775_RS10105 (M1775_10110) | 2179258..2179773 | + | 516 | WP_273585947.1 | flavin reductase family protein | - |
| M1775_RS10110 (M1775_10115) | 2179770..2180831 | + | 1062 | WP_003899092.1 | 3,4-dihydroxy-2-butanone-4-phosphate synthase | - |
| M1775_RS10115 (M1775_10120) | 2180828..2181598 | + | 771 | WP_003409775.1 | SDR family oxidoreductase | - |
| M1775_RS10120 (M1775_10125) | 2181808..2182137 | - | 330 | WP_003409778.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| M1775_RS10125 (M1775_10130) | 2182134..2182511 | - | 378 | WP_003409780.1 | type II toxin-antitoxin system antitoxin MazE5 | Antitoxin |
| M1775_RS10130 (M1775_10135) | 2182508..2183098 | - | 591 | WP_003910477.1 | SEC-C metal-binding domain-containing protein | - |
| M1775_RS10135 (M1775_10140) | 2183153..2184517 | + | 1365 | WP_003899094.1 | HNH endonuclease signature motif containing protein | - |
| M1775_RS10140 (M1775_10145) | 2184672..2185124 | - | 453 | WP_010950636.1 | lipoprotein | - |
| M1775_RS10145 (M1775_10150) | 2185188..2185589 | + | 402 | WP_003409869.1 | hypothetical protein | - |
| M1775_RS10150 (M1775_10155) | 2185582..2185764 | - | 183 | WP_003409870.1 | hypothetical protein | - |
| M1775_RS10155 (M1775_10160) | 2185878..2186228 | - | 351 | WP_003409871.1 | hypothetical protein | - |
| M1775_RS10160 (M1775_10165) | 2186239..2187141 | - | 903 | WP_003409874.1 | hypothetical protein | - |
| M1775_RS10165 (M1775_10170) | 2187162..2187353 | - | 192 | WP_003409876.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 110 a.a. Molecular weight: 11787.82 Da Isoelectric Point: 8.5361
>T243933 WP_003409778.1 NZ_CP096846:c2182137-2181808 [Mycobacterium tuberculosis variant bovis]
VTALPARGEVWWCEMAEIGRRPVVVLSRDAAIPRLRRALVAPCTTTIRGLASEVVLEPGSDPIPRRSAVNLDSVESVSVA
VLVNRLGRLADIRMRAICTALEVAVDCSR
VTALPARGEVWWCEMAEIGRRPVVVLSRDAAIPRLRRALVAPCTTTIRGLASEVVLEPGSDPIPRRSAVNLDSVESVSVA
VLVNRLGRLADIRMRAICTALEVAVDCSR
Download Length: 330 bp
Antitoxin
Download Length: 126 a.a. Molecular weight: 13560.07 Da Isoelectric Point: 5.1519
>AT243933 WP_003409780.1 NZ_CP096846:c2182511-2182134 [Mycobacterium tuberculosis variant bovis]
VKTARLQVTLRCAVDLINSSSDQCFARIEHVASDQADPRPGVWHSSGMNRIRLSTTVDAALLTSARDMRAGITDAALIDE
ALAALLARHRSAEVDASYAAYDKHPVDEPDEWGDLASWRRAAGDS
VKTARLQVTLRCAVDLINSSSDQCFARIEHVASDQADPRPGVWHSSGMNRIRLSTTVDAALLTSARDMRAGITDAALIDE
ALAALLARHRSAEVDASYAAYDKHPVDEPDEWGDLASWRRAAGDS
Download Length: 378 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|