Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
Location | 1928329..1928942 | Replicon | chromosome |
Accession | NZ_CP096846 | ||
Organism | Mycobacterium tuberculosis variant bovis strain Mb2377 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | P9WFA2 |
Locus tag | M1775_RS08990 | Protein ID | WP_003408465.1 |
Coordinates | 1928329..1928718 (-) | Length | 130 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | P9WJ52 |
Locus tag | M1775_RS08995 | Protein ID | WP_003408469.1 |
Coordinates | 1928715..1928942 (-) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M1775_RS08955 (M1775_08960) | 1923959..1924873 | + | 915 | WP_003898985.1 | 3-hydroxyacyl-CoA dehydrogenase family protein | - |
M1775_RS08960 (M1775_08965) | 1924876..1925706 | + | 831 | WP_003408448.1 | cyclase family protein | - |
M1775_RS08965 (M1775_08970) | 1925706..1926056 | + | 351 | WP_003898986.1 | cupin domain-containing protein | - |
M1775_RS08970 (M1775_08975) | 1926109..1926926 | + | 818 | Protein_1770 | 3-keto-5-aminohexanoate cleavage protein | - |
M1775_RS08975 (M1775_08980) | 1926940..1927719 | + | 780 | WP_003408460.1 | IclR family transcriptional regulator | - |
M1775_RS08985 (M1775_08990) | 1928150..1928281 | + | 132 | Protein_1772 | IS3 family transposase | - |
M1775_RS08990 (M1775_08995) | 1928329..1928718 | - | 390 | WP_003408465.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
M1775_RS08995 (M1775_09000) | 1928715..1928942 | - | 228 | WP_003408469.1 | antitoxin | Antitoxin |
M1775_RS09000 (M1775_09005) | 1929160..1930644 | + | 1485 | WP_010950580.1 | biotin carboxylase | - |
M1775_RS09005 (M1775_09010) | 1930641..1931888 | + | 1248 | WP_003408476.1 | serine hydrolase | - |
M1775_RS09010 (M1775_09015) | 1931931..1932350 | - | 420 | WP_003408483.1 | hypothetical protein | - |
M1775_RS09015 (M1775_09020) | 1932340..1933050 | - | 711 | WP_003408486.1 | winged helix-turn-helix transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 130 a.a. Molecular weight: 13817.98 Da Isoelectric Point: 7.0612
>T243931 WP_003408465.1 NZ_CP096846:c1928718-1928329 [Mycobacterium tuberculosis variant bovis]
VIVLDASAAVELMLTTPAGAAVARRLRGETVHAPAHFDVEVIGAIRQAVVRQLISDHEGLVVVVNFLSLPVRRWPLKPFT
QRAYQLRSTHTVADGAYVALAEGLGVPLITCDGRLAQSHGHNAEIELVA
VIVLDASAAVELMLTTPAGAAVARRLRGETVHAPAHFDVEVIGAIRQAVVRQLISDHEGLVVVVNFLSLPVRRWPLKPFT
QRAYQLRSTHTVADGAYVALAEGLGVPLITCDGRLAQSHGHNAEIELVA
Download Length: 390 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U4BUI9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U4FAN9 |