Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
| Location | 176886..177448 | Replicon | chromosome |
| Accession | NZ_CP096018 | ||
| Organism | Alkalimarinus coralli strain SCSIO 12817 | ||
Toxin (Protein)
| Gene name | ccdB | Uniprot ID | - |
| Locus tag | MY525_RS00800 | Protein ID | WP_250658083.1 |
| Coordinates | 176886..177203 (-) | Length | 106 a.a. |
Antitoxin (Protein)
| Gene name | ccdA | Uniprot ID | - |
| Locus tag | MY525_RS00805 | Protein ID | WP_250658084.1 |
| Coordinates | 177203..177448 (-) | Length | 82 a.a. |
Genomic Context
Location: 172094..172588 (495 bp)
Type: Others
Protein ID: WP_250658081.1
Type: Others
Protein ID: WP_250658081.1
Location: 178301..178531 (231 bp)
Type: Others
Protein ID: WP_250658085.1
Type: Others
Protein ID: WP_250658085.1
Location: 178531..178923 (393 bp)
Type: Others
Protein ID: WP_250658086.1
Type: Others
Protein ID: WP_250658086.1
Location: 179213..179761 (549 bp)
Type: Others
Protein ID: WP_250658087.1
Type: Others
Protein ID: WP_250658087.1
Location: 181126..181545 (420 bp)
Type: Others
Protein ID: WP_250658089.1
Type: Others
Protein ID: WP_250658089.1
Location: 181885..182367 (483 bp)
Type: Others
Protein ID: WP_250658090.1
Type: Others
Protein ID: WP_250658090.1
Location: 172589..174163 (1575 bp)
Type: Others
Protein ID: WP_250655122.1
Type: Others
Protein ID: WP_250655122.1
Location: 174188..174547 (360 bp)
Type: Others
Protein ID: WP_250655121.1
Type: Others
Protein ID: WP_250655121.1
Location: 174544..174858 (315 bp)
Type: Others
Protein ID: WP_250655120.1
Type: Others
Protein ID: WP_250655120.1
Location: 175337..175543 (207 bp)
Type: Others
Protein ID: Protein_154
Type: Others
Protein ID: Protein_154
Location: 175775..176761 (987 bp)
Type: Others
Protein ID: WP_250658082.1
Type: Others
Protein ID: WP_250658082.1
Location: 176886..177203 (318 bp)
Type: Toxin
Protein ID: WP_250658083.1
Type: Toxin
Protein ID: WP_250658083.1
Location: 177203..177448 (246 bp)
Type: Antitoxin
Protein ID: WP_250658084.1
Type: Antitoxin
Protein ID: WP_250658084.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MY525_RS00770 | 172094..172588 | + | 495 | WP_250658081.1 | GIY-YIG nuclease family protein | - |
| MY525_RS00775 | 172589..174163 | - | 1575 | WP_250655122.1 | IS66 family transposase | - |
| MY525_RS00780 | 174188..174547 | - | 360 | WP_250655121.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| MY525_RS00785 | 174544..174858 | - | 315 | WP_250655120.1 | hypothetical protein | - |
| MY525_RS00790 | 175337..175543 | - | 207 | Protein_154 | group II intron reverse transcriptase/maturase | - |
| MY525_RS00795 | 175775..176761 | - | 987 | WP_250658082.1 | transposase | - |
| MY525_RS00800 | 176886..177203 | - | 318 | WP_250658083.1 | CcdB family protein | Toxin |
| MY525_RS00805 | 177203..177448 | - | 246 | WP_250658084.1 | type II toxin-antitoxin system CcdA family antitoxin | Antitoxin |
| MY525_RS00810 | 178301..178531 | + | 231 | WP_250658085.1 | hypothetical protein | - |
| MY525_RS00815 | 178531..178923 | + | 393 | WP_250658086.1 | type II toxin-antitoxin system VapC family toxin | - |
| MY525_RS00820 | 179213..179761 | + | 549 | WP_250658087.1 | hypothetical protein | - |
| MY525_RS00830 | 181126..181545 | + | 420 | WP_250658089.1 | hypothetical protein | - |
| MY525_RS00835 | 181885..182367 | + | 483 | WP_250658090.1 | hypothetical protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 174188..174547 | 359 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 11871.72 Da Isoelectric Point: 6.9744
>T242709 WP_250658083.1 NZ_CP096018:c177203-176886 [Alkalimarinus coralli]
MTQFTLYKNEDRSSRKTYPYFVNVQSDLLKDLNSRLVIPLSPGSAVNNTNAKKLCPIINLDEGSFILLAHQMTSVPRSIL
KAEVTSLESYRYEIMDAIDMLITGI
MTQFTLYKNEDRSSRKTYPYFVNVQSDLLKDLNSRLVIPLSPGSAVNNTNAKKLCPIINLDEGSFILLAHQMTSVPRSIL
KAEVTSLESYRYEIMDAIDMLITGI
Download Length: 318 bp
>T242709 NZ_OW849527:2155921-2156024 [Citrobacter freundii]
GGCAGGGTAACTTAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATAC
AGGAATCGTATTCGGTCTCTTTTT
GGCAGGGTAACTTAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATAC
AGGAATCGTATTCGGTCTCTTTTT
Antitoxin
Download Length: 82 a.a. Molecular weight: 9149.26 Da Isoelectric Point: 4.7558
>AT242709 WP_250658084.1 NZ_CP096018:c177448-177203 [Alkalimarinus coralli]
MQQAFNENAPKKATNLSINSDLLNKARGLKINLSATLEQALTIQVRNAERELWVEENKEAIQALNELADKNGLFSDSFRD
F
MQQAFNENAPKKATNLSINSDLLNKARGLKINLSATLEQALTIQVRNAERELWVEENKEAIQALNELADKNGLFSDSFRD
F
Download Length: 246 bp
>AT242709 NZ_OW849527:c2156029-2155886 [Citrobacter freundii]
CACATAAAAAGAGACCGAATACGATTCCTGTATTCGGTCCAGGGAAATGGCTCTTGGGAGAGAGCCGTGCGCTAAAAGTT
GGCATTAATGCAGGCTAAGTTACCCTGCCATTTAAGAATAGATGACAGCGCCAGGTTTTCCAGT
CACATAAAAAGAGACCGAATACGATTCCTGTATTCGGTCCAGGGAAATGGCTCTTGGGAGAGAGCCGTGCGCTAAAAGTT
GGCATTAATGCAGGCTAAGTTACCCTGCCATTTAAGAATAGATGACAGCGCCAGGTTTTCCAGT