Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | relBE/RelE(toxin) |
Location | 183995..184561 | Replicon | chromosome |
Accession | NZ_CP096017 | ||
Organism | Alkalimarinus coralli strain SCSIO 12638 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | MY524_RS00840 | Protein ID | WP_250658091.1 |
Coordinates | 183995..184279 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | MY524_RS00845 | Protein ID | WP_250658092.1 |
Coordinates | 184283..184561 (-) | Length | 93 a.a. |
Genomic Context
Location: 179711..179941 (231 bp)
Type: Others
Protein ID: WP_250658085.1
Type: Others
Protein ID: WP_250658085.1
Location: 179941..180333 (393 bp)
Type: Others
Protein ID: WP_250658086.1
Type: Others
Protein ID: WP_250658086.1
Location: 180623..181171 (549 bp)
Type: Others
Protein ID: WP_250658087.1
Type: Others
Protein ID: WP_250658087.1
Location: 182536..182955 (420 bp)
Type: Others
Protein ID: WP_250658089.1
Type: Others
Protein ID: WP_250658089.1
Location: 183295..183777 (483 bp)
Type: Others
Protein ID: WP_250658090.1
Type: Others
Protein ID: WP_250658090.1
Location: 184902..185405 (504 bp)
Type: Others
Protein ID: WP_250658093.1
Type: Others
Protein ID: WP_250658093.1
Location: 185472..185843 (372 bp)
Type: Others
Protein ID: WP_250658094.1
Type: Others
Protein ID: WP_250658094.1
Location: 183995..184279 (285 bp)
Type: Toxin
Protein ID: WP_250658091.1
Type: Toxin
Protein ID: WP_250658091.1
Location: 184283..184561 (279 bp)
Type: Antitoxin
Protein ID: WP_250658092.1
Type: Antitoxin
Protein ID: WP_250658092.1
Location: 186054..187010 (957 bp)
Type: Others
Protein ID: WP_250658095.1
Type: Others
Protein ID: WP_250658095.1
Location: 187064..187468 (405 bp)
Type: Others
Protein ID: WP_250658096.1
Type: Others
Protein ID: WP_250658096.1
Location: 187783..189231 (1449 bp)
Type: Others
Protein ID: WP_250658097.1
Type: Others
Protein ID: WP_250658097.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MY524_RS00810 | 179711..179941 | + | 231 | WP_250658085.1 | hypothetical protein | - |
MY524_RS00815 | 179941..180333 | + | 393 | WP_250658086.1 | type II toxin-antitoxin system VapC family toxin | - |
MY524_RS00820 | 180623..181171 | + | 549 | WP_250658087.1 | hypothetical protein | - |
MY524_RS00830 | 182536..182955 | + | 420 | WP_250658089.1 | hypothetical protein | - |
MY524_RS00835 | 183295..183777 | + | 483 | WP_250658090.1 | hypothetical protein | - |
MY524_RS00840 | 183995..184279 | - | 285 | WP_250658091.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
MY524_RS00845 | 184283..184561 | - | 279 | WP_250658092.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
MY524_RS00850 | 184902..185405 | + | 504 | WP_250658093.1 | hypothetical protein | - |
MY524_RS00855 | 185472..185843 | + | 372 | WP_250658094.1 | helix-turn-helix domain-containing protein | - |
MY524_RS00860 | 186054..187010 | - | 957 | WP_250658095.1 | PA2778 family cysteine peptidase | - |
MY524_RS00865 | 187064..187468 | - | 405 | WP_250658096.1 | PA2779 family protein | - |
MY524_RS00870 | 187783..189231 | - | 1449 | WP_250658097.1 | aldehyde dehydrogenase family protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
No matching records found |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11183.95 Da Isoelectric Point: 6.4718
>T242699 WP_250658091.1 NZ_CP096017:c184279-183995 [Alkalimarinus coralli]
VIYWEEESLNDRERIFEFLYDFNPIAAEKTDKIIEEKVENLHQQPLMGVQRGGIQGRLLVIPEISMIVSYWTDNTVIRVM
RVLHQKQKFPAKRP
VIYWEEESLNDRERIFEFLYDFNPIAAEKTDKIIEEKVENLHQQPLMGVQRGGIQGRLLVIPEISMIVSYWTDNTVIRVM
RVLHQKQKFPAKRP
Download Length: 285 bp
>T242699 NZ_OW849470:2195825-2195928 [Klebsiella oxytoca]
GGCAAGGCGACTTAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATAC
AGGAATCGTGTTCGGTCTTTTTTT
GGCAAGGCGACTTAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATAC
AGGAATCGTGTTCGGTCTTTTTTT
Antitoxin
Download Length: 93 a.a. Molecular weight: 10885.07 Da Isoelectric Point: 7.8949
>AT242699 WP_250658092.1 NZ_CP096017:c184561-184283 [Alkalimarinus coralli]
MDTRVQFRIDEETKRLAQQRTESQGRTLSDACRELTEQLADQQRKATSHDAWLTEQVNLAFEKFQTNRSTFVEHEHAKSS
MSERKAKIRERC
MDTRVQFRIDEETKRLAQQRTESQGRTLSDACRELTEQLADQQRKATSHDAWLTEQVNLAFEKFQTNRSTFVEHEHAKSS
MSERKAKIRERC
Download Length: 279 bp
>AT242699 NZ_OW849470:c2195935-2195790 [Klebsiella oxytoca]
AAAAGATAAAAAAAGACCGAACACGATTCCTGTATTCGGTCCAGGGAAATGGCTCTTGGGAGAGAGCCGTGCGCTAAAAG
TTGGCATTAATGCAGGCTAAGTCGCCTTGCCTTATAAGAATAGTTTACCGTGTCAGGTTTTCCAGT
AAAAGATAAAAAAAGACCGAACACGATTCCTGTATTCGGTCCAGGGAAATGGCTCTTGGGAGAGAGCCGTGCGCTAAAAG
TTGGCATTAATGCAGGCTAAGTCGCCTTGCCTTATAAGAATAGTTTACCGTGTCAGGTTTTCCAGT