Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 49798..50441 Replicon plasmid pK666_mcr-10
Accession NZ_CP095171
Organism Enterobacter roggenkampii strain K666

Toxin (Protein)


Gene name vagD Uniprot ID A0A155IU92
Locus tag MUY33_RS24140 Protein ID WP_000754567.1
Coordinates 49798..50214 (-) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID A0A155IUD1
Locus tag MUY33_RS24145 Protein ID WP_023293777.1
Coordinates 50211..50441 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
MUY33_RS24110 (MUY33_24110) 44984..45565 + 582 WP_032676110.1 TetR/AcrR family transcriptional regulator -
MUY33_RS24115 (MUY33_24115) 45570..45908 + 339 WP_000888080.1 carboxymuconolactone decarboxylase family protein -
MUY33_RS24120 (MUY33_24120) 45938..46267 - 330 WP_008502229.1 thioredoxin family protein -
MUY33_RS24125 (MUY33_24125) 46480..47586 + 1107 WP_006687059.1 alkene reductase -
MUY33_RS24130 (MUY33_24130) 47652..48353 + 702 WP_008502228.1 DsbA family oxidoreductase -
MUY33_RS24135 (MUY33_24135) 48479..49447 + 969 WP_084832609.1 IS5-like element IS903B family transposase -
MUY33_RS24140 (MUY33_24140) 49798..50214 - 417 WP_000754567.1 type II toxin-antitoxin system VapC family toxin Toxin
MUY33_RS24145 (MUY33_24145) 50211..50441 - 231 WP_023293777.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
MUY33_RS24150 (MUY33_24150) 50579..51133 + 555 WP_161646454.1 hypothetical protein -
MUY33_RS24155 (MUY33_24155) 51221..51292 - 72 Protein_58 hypothetical protein -
MUY33_RS24160 (MUY33_24160) 51422..52627 + 1206 WP_006797591.1 AAA family ATPase -
MUY33_RS24165 (MUY33_24165) 52627..53601 + 975 WP_000064119.1 ParB family protein -
MUY33_RS24170 (MUY33_24170) 53683..54954 - 1272 WP_032627083.1 Y-family DNA polymerase -
MUY33_RS24175 (MUY33_24175) 54954..55385 - 432 WP_006796638.1 translesion error-prone DNA polymerase V autoproteolytic subunit -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid blaTEM-1B / blaLAP-2 / qnrS1 / mcr-10 mrkF / mrkD / mrkC / mrkB / mrkA 1..136140 136140


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(6-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15108.61 Da        Isoelectric Point: 8.5403

>T241661 WP_000754567.1 NZ_CP095171:c50214-49798 [Enterobacter roggenkampii]
MKKTWMLDTNICSFIMREQPAAVLKRLEQVVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPGLVLEDWVK

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8706.73 Da        Isoelectric Point: 4.4299

>AT241661 WP_023293777.1 NZ_CP095171:c50441-50211 [Enterobacter roggenkampii]
MRTVSIFKNGNNRAIRLPRDLDFDGVSELEIVREGDSIILRPVRPTWGSFAQLDRADPDFMAQREDVVSDEGRFDP

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A155IU92

Antitoxin

Source ID Structure
AlphaFold DB A0A155IUD1

References