Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 15100..15743 Replicon plasmid pK666_mcr-10
Accession NZ_CP095171
Organism Enterobacter roggenkampii strain K666

Toxin (Protein)


Gene name vagD Uniprot ID A0A5P6KDG5
Locus tag MUY33_RS23935 Protein ID WP_021312768.1
Coordinates 15327..15743 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID A0A5P6KGW8
Locus tag MUY33_RS23930 Protein ID WP_021312767.1
Coordinates 15100..15330 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
MUY33_RS23900 (MUY33_23900) 10417..11685 + 1269 WP_019705993.1 ISL3-like element ISKpn25 family transposase -
MUY33_RS23905 (MUY33_23905) 12020..13036 - 1017 WP_020315256.1 hypothetical protein -
MUY33_RS23910 (MUY33_23910) 13033..13356 - 324 WP_022644730.1 hypothetical protein -
MUY33_RS23915 (MUY33_23915) 13383..13778 - 396 WP_072158608.1 hypothetical protein -
MUY33_RS23920 (MUY33_23920) 13947..14252 - 306 WP_001568026.1 type II toxin-antitoxin system toxin CcdB -
MUY33_RS23925 (MUY33_23925) 14254..14472 - 219 WP_001568025.1 type II toxin-antitoxin system antitoxin CcdA -
MUY33_RS23930 (MUY33_23930) 15100..15330 + 231 WP_021312767.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
MUY33_RS23935 (MUY33_23935) 15327..15743 + 417 WP_021312768.1 type II toxin-antitoxin system VapC family toxin Toxin
MUY33_RS23940 (MUY33_23940) 15841..16011 - 171 WP_228264702.1 helix-turn-helix domain-containing protein -
MUY33_RS23945 (MUY33_23945) 16051..16753 - 703 Protein_16 IS6-like element IS26 family transposase -
MUY33_RS23950 (MUY33_23950) 17058..18059 - 1002 Protein_17 IS110-like element IS4321 family transposase -
MUY33_RS23955 (MUY33_23955) 18183..18885 + 703 Protein_18 IS6-like element IS26 family transposase -
MUY33_RS23960 (MUY33_23960) 19191..19748 + 558 WP_001235713.1 recombinase family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid blaTEM-1B / blaLAP-2 / qnrS1 / mcr-10 mrkF / mrkD / mrkC / mrkB / mrkA 1..136140 136140
- inside IScluster/Tn blaTEM-1B / blaLAP-2 / qnrS1 - 10417..28276 17859


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-50)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15175.60 Da        Isoelectric Point: 7.2452

>T241660 WP_021312768.1 NZ_CP095171:15327-15743 [Enterobacter roggenkampii]
VNKIYMLDTNICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCARLDAILPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFERVPDLVLEDWVR

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8722.81 Da        Isoelectric Point: 4.4692

>AT241660 WP_021312767.1 NZ_CP095171:15100-15330 [Enterobacter roggenkampii]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFAQLEKADPDFMAEREDVVSDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5P6KDG5

Antitoxin

Source ID Structure
AlphaFold DB A0A5P6KGW8

References