Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tsbAT/- |
Location | 1909257..1910033 | Replicon | chromosome |
Accession | NZ_CP094928 | ||
Organism | Staphylococcus aureus strain 8 |
Toxin (Protein)
Gene name | tsbT | Uniprot ID | X5E2E6 |
Locus tag | MUO44_RS09180 | Protein ID | WP_000031108.1 |
Coordinates | 1909257..1909409 (-) | Length | 51 a.a. |
Antitoxin (Protein)
Gene name | tsbA | Uniprot ID | W8U4V4 |
Locus tag | MUO44_RS09185 | Protein ID | WP_001251224.1 |
Coordinates | 1909434..1910033 (-) | Length | 200 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MUO44_RS09165 (MUO44_09165) | 1905393..1906214 | + | 822 | WP_000669376.1 | RluA family pseudouridine synthase | - |
MUO44_RS09170 (MUO44_09170) | 1906675..1908060 | - | 1386 | WP_000116229.1 | class II fumarate hydratase | - |
MUO44_RS09175 (MUO44_09175) | 1908256..1908651 | - | 396 | WP_000901023.1 | hypothetical protein | - |
MUO44_RS09180 (MUO44_09180) | 1909257..1909409 | - | 153 | WP_000031108.1 | SAS053 family protein | Toxin |
MUO44_RS09185 (MUO44_09185) | 1909434..1910033 | - | 600 | WP_001251224.1 | glucosamine-6-phosphate isomerase | Antitoxin |
MUO44_RS09190 (MUO44_09190) | 1910192..1910662 | - | 471 | WP_000181394.1 | tRNA (uridine(34)/cytosine(34)/5- carboxymethylaminomethyluridine(34)-2'-O)- methyltransferase TrmL | - |
MUO44_RS09195 (MUO44_09195) | 1910667..1911794 | - | 1128 | WP_277446050.1 | tRNA epoxyqueuosine(34) reductase QueG | - |
MUO44_RS09200 (MUO44_09200) | 1911945..1912667 | - | 723 | WP_000590809.1 | amino acid ABC transporter ATP-binding protein | - |
MUO44_RS09205 (MUO44_09205) | 1912660..1914117 | - | 1458 | WP_000649907.1 | ABC transporter permease subunit | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5936.28 Da Isoelectric Point: 3.8962
>T240794 WP_000031108.1 NZ_CP094928:c1909409-1909257 [Staphylococcus aureus]
MSKDKDPKLNYHEEENSMVTDFEDLKELGKEMEQISDQNDQEKNSEEDSQ
MSKDKDPKLNYHEEENSMVTDFEDLKELGKEMEQISDQNDQEKNSEEDSQ
Download Length: 153 bp
Antitoxin
Download Length: 200 a.a. Molecular weight: 22343.47 Da Isoelectric Point: 5.1445
>AT240794 WP_001251224.1 NZ_CP094928:c1910033-1909434 [Staphylococcus aureus]
MAMNFKVFDNSQLVAEYAADIIRKQFNNNPTTIAGFHLDTDQAPVLDELKKNVEKHAVDFSQINILDYDDKKSYFEALGV
PAGQVYPIAYEKDAIELIADKIKTKENKGKLTLQVVSIDEQGKLNVSIRQGLMEAREIFLVVTGANKRDVVEKLYQENGK
TSFEPADLKAHRMVNVILDKEAAAGLPEDVKAYFTSRFA
MAMNFKVFDNSQLVAEYAADIIRKQFNNNPTTIAGFHLDTDQAPVLDELKKNVEKHAVDFSQINILDYDDKKSYFEALGV
PAGQVYPIAYEKDAIELIADKIKTKENKGKLTLQVVSIDEQGKLNVSIRQGLMEAREIFLVVTGANKRDVVEKLYQENGK
TSFEPADLKAHRMVNVILDKEAAAGLPEDVKAYFTSRFA
Download Length: 600 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|