Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) /HTH_19(antitoxin)
Location 2190548..2191339 Replicon chromosome
Accession NZ_CP094819
Organism Mammaliicoccus sciuri strain IVB6228

Toxin (Protein)


Gene name - Uniprot ID -
Locus tag MUA42_RS11055 Protein ID WP_262641733.1
Coordinates 2190875..2191339 (+) Length 155 a.a.

Antitoxin (Protein)


Gene name - Uniprot ID -
Locus tag MUA42_RS11050 Protein ID WP_262641732.1
Coordinates 2190548..2190862 (+) Length 105 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
MUA42_RS10970 (MUA42_10970) 2185593..2186132 - 540 WP_262641719.1 host-nuclease inhibitor Gam family protein -
MUA42_RS10975 (MUA42_10975) 2186125..2186394 - 270 WP_262641720.1 hypothetical protein -
MUA42_RS10980 (MUA42_10980) 2186397..2186657 - 261 WP_262641721.1 hypothetical protein -
MUA42_RS10985 (MUA42_10985) 2186750..2186947 - 198 WP_262641722.1 hypothetical protein -
MUA42_RS10990 (MUA42_10990) 2186944..2187216 - 273 WP_262641723.1 hypothetical protein -
MUA42_RS10995 (MUA42_10995) 2187217..2187459 - 243 WP_262641724.1 hypothetical protein -
MUA42_RS11000 (MUA42_11000) 2187532..2187771 + 240 WP_262641725.1 DUF1883 domain-containing protein -
MUA42_RS11005 (MUA42_11005) 2187800..2187955 - 156 WP_262641726.1 hypothetical protein -
MUA42_RS11010 (MUA42_11010) 2187956..2188111 - 156 WP_262641728.1 hypothetical protein -
MUA42_RS11015 (MUA42_11015) 2188112..2188324 - 213 WP_206180412.1 hypothetical protein -
MUA42_RS11020 (MUA42_11020) 2188381..2188620 + 240 WP_262641729.1 hypothetical protein -
MUA42_RS11025 (MUA42_11025) 2188568..2188765 - 198 WP_262641730.1 hypothetical protein -
MUA42_RS11030 (MUA42_11030) 2188814..2189194 + 381 WP_218697269.1 DUF2513 domain-containing protein -
MUA42_RS11035 (MUA42_11035) 2189181..2189375 - 195 WP_218697268.1 hypothetical protein -
MUA42_RS11040 (MUA42_11040) 2189396..2190142 - 747 WP_262641731.1 phage antirepressor KilAC domain-containing protein -
MUA42_RS11045 (MUA42_11045) 2190158..2190394 - 237 WP_262619693.1 helix-turn-helix transcriptional regulator -
MUA42_RS11050 (MUA42_11050) 2190548..2190862 + 315 WP_262641732.1 helix-turn-helix transcriptional regulator Antitoxin
MUA42_RS11055 (MUA42_11055) 2190875..2191339 + 465 WP_262641733.1 ImmA/IrrE family metallo-endopeptidase Toxin
MUA42_RS11060 (MUA42_11060) 2191354..2191938 + 585 WP_262641735.1 DUF4352 domain-containing protein -
MUA42_RS11065 (MUA42_11065) 2191986..2192297 + 312 WP_262641736.1 S24 family peptidase -
MUA42_RS11070 (MUA42_11070) 2192312..2192623 + 312 WP_262641737.1 hypothetical protein -
MUA42_RS11075 (MUA42_11075) 2192659..2192841 + 183 WP_242449798.1 hypothetical protein -
MUA42_RS11080 (MUA42_11080) 2193048..2193932 + 885 WP_262641738.1 hypothetical protein -
MUA42_RS11085 (MUA42_11085) 2193920..2194111 - 192 WP_262641739.1 hypothetical protein -
MUA42_RS11090 (MUA42_11090) 2194481..2195134 + 654 WP_262641740.1 CPBP family intramembrane metalloprotease -
MUA42_RS11095 (MUA42_11095) 2195201..2196250 + 1050 WP_262641741.1 site-specific integrase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 2120569..2199562 78993


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

IrrE N-terminal-like domain

(32-116)

Antitoxin

Cro/C1-type helix-turn-helix domain

(4-62)


Sequences

Toxin        


Download         Length: 155 a.a.        Molecular weight: 18245.74 Da        Isoelectric Point: 5.8235

>T240608 WP_262641733.1 NZ_CP094819:2190875-2191339 [Mammaliicoccus sciuri]
MGLYEETLIQHDYIEVREANVLPDDLDGVWLGDLILIKRNLPEKKKVEVLFEELAHHKLTYGDITNQKQFNNRKFENYAR
RYSYEKSMPLSGIVQAFEQGVHNLYELANFFEISEGHVLDCIEHYKAKYGLSTYHKGYVIKFDPLQVFKHIEFE

Download         Length: 465 bp

>T240608 NZ_LT598688:c2269857-2269753 [Staphylococcus aureus]
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTTATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA

Antitoxin


Download         Length: 105 a.a.        Molecular weight: 12104.62 Da        Isoelectric Point: 7.1663

>AT240608 WP_262641732.1 NZ_CP094819:2190548-2190862 [Mammaliicoccus sciuri]
MCFSKRMKQSREKQGMTLAELGRKIGKTEATVQRYESGNIKNLKNDTIESIAEALNVNPAYLMGWIDEDNDEVQHRAAHL
EGNLTDDEWKRVLDYADYIRSRRK

Download         Length: 315 bp

>AT240608 NZ_LT598688:2269659-2269697 [Staphylococcus aureus]
AACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGAC

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References