Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicB-HicA |
| Location | 169446..170063 | Replicon | plasmid pNY2032-1 |
| Accession | NZ_CP093942 | ||
| Organism | Enterococcus faecium strain NY2032 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | - |
| Locus tag | MPL11_RS14595 | Protein ID | WP_224451579.1 |
| Coordinates | 169911..170063 (-) | Length | 51 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | A0A829EWE8 |
| Locus tag | MPL11_RS14590 | Protein ID | WP_002305052.1 |
| Coordinates | 169446..169877 (-) | Length | 144 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MPL11_RS14575 (MPL11_14575) | 165261..166688 | - | 1428 | WP_002322784.1 | glycoside hydrolase family 32 protein | - |
| MPL11_RS14580 (MPL11_14580) | 166742..168016 | - | 1275 | WP_002323715.1 | MFS transporter | - |
| MPL11_RS14585 (MPL11_14585) | 168319..169272 | + | 954 | WP_242815714.1 | IS30 family transposase | - |
| MPL11_RS14590 (MPL11_14590) | 169446..169877 | - | 432 | WP_002305052.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| MPL11_RS14595 (MPL11_14595) | 169911..170063 | - | 153 | WP_224451579.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| MPL11_RS14600 (MPL11_14600) | 170157..170336 | - | 180 | Protein_183 | hypothetical protein | - |
| MPL11_RS14605 (MPL11_14605) | 170352..170552 | - | 201 | WP_002324500.1 | hypothetical protein | - |
| MPL11_RS14610 (MPL11_14610) | 170717..171412 | - | 696 | WP_002305050.1 | hypothetical protein | - |
| MPL11_RS14615 (MPL11_14615) | 171405..171842 | - | 438 | WP_002305049.1 | hypothetical protein | - |
| MPL11_RS14620 (MPL11_14620) | 171858..172109 | - | 252 | WP_002287517.1 | hypothetical protein | - |
| MPL11_RS14625 (MPL11_14625) | 172109..172315 | - | 207 | WP_002324499.1 | hypothetical protein | - |
| MPL11_RS14630 (MPL11_14630) | 172759..173019 | - | 261 | WP_002326514.1 | hypothetical protein | - |
| MPL11_RS14635 (MPL11_14635) | 173152..173296 | + | 145 | Protein_190 | type I toxin-antitoxin system toxin PepG1 | - |
| MPL11_RS14640 (MPL11_14640) | 173455..173658 | - | 204 | Protein_191 | hypothetical protein | - |
| MPL11_RS14645 (MPL11_14645) | 173653..173739 | - | 87 | Protein_192 | IS200/IS605 family transposase | - |
| MPL11_RS14650 (MPL11_14650) | 174007..174483 | - | 477 | WP_002305045.1 | PTS glucose transporter subunit IIA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | aac(6')-aph(2'') | - | 1..255599 | 255599 | |
| - | flank | IS/Tn | - | - | 168319..169272 | 953 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5815.65 Da Isoelectric Point: 10.3560
>T239126 WP_224451579.1 NZ_CP093942:c170063-169911 [Enterococcus faecium]
IEKNGWVERRQEGFHHHLYKDGVRITVPVHANQDLGRGLERKILKDAGLK
IEKNGWVERRQEGFHHHLYKDGVRITVPVHANQDLGRGLERKILKDAGLK
Download Length: 153 bp
>T239126 NZ_LR890606:2757071-2757178 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 144 a.a. Molecular weight: 15811.92 Da Isoelectric Point: 4.1638
>AT239126 WP_002305052.1 NZ_CP093942:c169877-169446 [Enterococcus faecium]
MLSEPLAKTYPAIFSPEEGGGYFIEFPDVQGAYTGINEDDISYGIAMAQEVLGMVLADYIEHEDLLPEPTPINKISVEDD
SFTTLIRVDVAKYLKDTELVKKTLTIPQWADKLGKRAGINFSVLLTESIADKADNILRSGRNN
MLSEPLAKTYPAIFSPEEGGGYFIEFPDVQGAYTGINEDDISYGIAMAQEVLGMVLADYIEHEDLLPEPTPINKISVEDD
SFTTLIRVDVAKYLKDTELVKKTLTIPQWADKLGKRAGINFSVLLTESIADKADNILRSGRNN
Download Length: 432 bp
>AT239126 NZ_LR890606:c2757024-2756958 [Escherichia coli]
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|