Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
Location | 90924..91501 | Replicon | plasmid pW17-3-a |
Accession | NZ_CP093261 | ||
Organism | Moellerella wisconsensis strain W17-3 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | U5N651 |
Locus tag | MNY68_RS16250 | Protein ID | WP_023159957.1 |
Coordinates | 91169..91501 (+) | Length | 111 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | U5N340 |
Locus tag | MNY68_RS16245 | Protein ID | WP_023159984.1 |
Coordinates | 90924..91169 (+) | Length | 82 a.a. |
Genomic Context
Location: 85937..86281 (345 bp)
Type: Others
Protein ID: WP_023159966.1
Type: Others
Protein ID: WP_023159966.1
Location: 86274..86696 (423 bp)
Type: Others
Protein ID: WP_048821775.1
Type: Others
Protein ID: WP_048821775.1
Location: 86706..87098 (393 bp)
Type: Others
Protein ID: WP_048821774.1
Type: Others
Protein ID: WP_048821774.1
Location: 87379..87858 (480 bp)
Type: Others
Protein ID: WP_048821772.1
Type: Others
Protein ID: WP_048821772.1
Location: 87867..88445 (579 bp)
Type: Others
Protein ID: WP_048822182.1
Type: Others
Protein ID: WP_048822182.1
Location: 89206..89574 (369 bp)
Type: Others
Protein ID: WP_048821769.1
Type: Others
Protein ID: WP_048821769.1
Location: 90924..91169 (246 bp)
Type: Antitoxin
Protein ID: WP_023159984.1
Type: Antitoxin
Protein ID: WP_023159984.1
Location: 91169..91501 (333 bp)
Type: Toxin
Protein ID: WP_023159957.1
Type: Toxin
Protein ID: WP_023159957.1
Location: 91532..91912 (381 bp)
Type: Others
Protein ID: WP_048821763.1
Type: Others
Protein ID: WP_048821763.1
Location: 93874..94827 (954 bp)
Type: Others
Protein ID: WP_048821757.1
Type: Others
Protein ID: WP_048821757.1
Location: 94843..94977 (135 bp)
Type: Others
Protein ID: WP_256326490.1
Type: Others
Protein ID: WP_256326490.1
Location: 95096..95917 (822 bp)
Type: Others
Protein ID: WP_001029679.1
Type: Others
Protein ID: WP_001029679.1
Location: 89672..89899 (228 bp)
Type: Others
Protein ID: WP_048821767.1
Type: Others
Protein ID: WP_048821767.1
Location: 90008..90631 (624 bp)
Type: Others
Protein ID: WP_023159958.1
Type: Others
Protein ID: WP_023159958.1
Location: 92001..92141 (141 bp)
Type: Others
Protein ID: WP_072022937.1
Type: Others
Protein ID: WP_072022937.1
Location: 92461..92919 (459 bp)
Type: Others
Protein ID: WP_048821762.1
Type: Others
Protein ID: WP_048821762.1
Location: 93018..93272 (255 bp)
Type: Others
Protein ID: WP_048821760.1
Type: Others
Protein ID: WP_048821760.1
Location: 93311..93580 (270 bp)
Type: Others
Protein ID: WP_048821758.1
Type: Others
Protein ID: WP_048821758.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MNY68_RS16205 (MNY68_16205) | 85937..86281 | + | 345 | WP_023159966.1 | single-stranded DNA-binding protein | - |
MNY68_RS16210 (MNY68_16210) | 86274..86696 | + | 423 | WP_048821775.1 | hypothetical protein | - |
MNY68_RS16215 (MNY68_16215) | 86706..87098 | + | 393 | WP_048821774.1 | hypothetical protein | - |
MNY68_RS16220 (MNY68_16220) | 87379..87858 | + | 480 | WP_048821772.1 | Hcp family type VI secretion system effector | - |
MNY68_RS16225 (MNY68_16225) | 87867..88445 | + | 579 | WP_048822182.1 | hypothetical protein | - |
MNY68_RS16230 (MNY68_16230) | 89206..89574 | + | 369 | WP_048821769.1 | hypothetical protein | - |
MNY68_RS16235 (MNY68_16235) | 89672..89899 | - | 228 | WP_048821767.1 | plasmid partition protein ParG | - |
MNY68_RS16240 (MNY68_16240) | 90008..90631 | - | 624 | WP_023159958.1 | AAA family ATPase | - |
MNY68_RS16245 (MNY68_16245) | 90924..91169 | + | 246 | WP_023159984.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
MNY68_RS16250 (MNY68_16250) | 91169..91501 | + | 333 | WP_023159957.1 | endoribonuclease MazF | Toxin |
MNY68_RS16255 (MNY68_16255) | 91532..91912 | + | 381 | WP_048821763.1 | hypothetical protein | - |
MNY68_RS16260 (MNY68_16260) | 92001..92141 | - | 141 | WP_072022937.1 | Hok/Gef family protein | - |
MNY68_RS16265 (MNY68_16265) | 92461..92919 | - | 459 | WP_048821762.1 | hypothetical protein | - |
MNY68_RS16270 (MNY68_16270) | 93018..93272 | - | 255 | WP_048821760.1 | hypothetical protein | - |
MNY68_RS16275 (MNY68_16275) | 93311..93580 | - | 270 | WP_048821758.1 | hypothetical protein | - |
MNY68_RS16280 (MNY68_16280) | 93874..94827 | + | 954 | WP_048821757.1 | site-specific integrase | - |
MNY68_RS16355 | 94843..94977 | + | 135 | WP_256326490.1 | hypothetical protein | - |
MNY68_RS16285 (MNY68_16285) | 95096..95917 | + | 822 | WP_001029679.1 | TnsA endonuclease N-terminal domain-containing protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | blaCTX-M-32 / aph(3')-Ia / sul1 / qacE / ant(3'')-Ia / dfrA1 / lnu(F) | - | 1..102837 | 102837 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 12097.88 Da Isoelectric Point: 7.0813
>T237955 WP_023159957.1 NZ_CP093261:91169-91501 [Moellerella wisconsensis]
MVSRYVPDSGDLIWIDFDPVEGHEQGGHRPAVVLSPFAYNNKVGLLLCVPCTTKGKGYPFECELSNERDSYALADQVTCV
DWRARKVTKKGKVEASELAEIKAKAKALIG
MVSRYVPDSGDLIWIDFDPVEGHEQGGHRPAVVLSPFAYNNKVGLLLCVPCTTKGKGYPFECELSNERDSYALADQVTCV
DWRARKVTKKGKVEASELAEIKAKAKALIG
Download Length: 333 bp
>T237955 NZ_LR883050:208590-208697 [Escherichia coli]
ATGACGTTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
ATGACGTTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
Antitoxin
Download Length: 82 a.a. Molecular weight: 8786.20 Da Isoelectric Point: 5.0351
>AT237955 WP_023159984.1 NZ_CP093261:90924-91169 [Moellerella wisconsensis]
MAQVTVKKWGNSPSVRLPVAIMQKAALSVDDTVEIAVEEGRIIITPVKAVEYSLDNLLAGITPENIHEKVDFGARTGKEL
I
MAQVTVKKWGNSPSVRLPVAIMQKAALSVDDTVEIAVEEGRIIITPVKAVEYSLDNLLAGITPENIHEKVDFGARTGKEL
I
Download Length: 246 bp
>AT237955 NZ_LR883050:c208542-208476 [Escherichia coli]
GGTCTAGAGTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT
GGTCTAGAGTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2P1BQ75 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A857E7M9 |