Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapB(antitoxin) |
Location | 51829..52403 | Replicon | plasmid pW49-2-a |
Accession | NZ_CP093240 | ||
Organism | Escherichia marmotae strain W49-2 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | A0A449CCI1 |
Locus tag | MNY74_RS24800 | Protein ID | WP_000604347.1 |
Coordinates | 52029..52403 (+) | Length | 125 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | MNY74_RS24795 | Protein ID | WP_097468730.1 |
Coordinates | 51829..52032 (+) | Length | 68 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MNY74_RS24765 (46967) | 46967..47746 | + | 780 | Protein_67 | DUF4942 domain-containing protein | - |
MNY74_RS24770 (47791) | 47791..48042 | - | 252 | WP_061361338.1 | helix-turn-helix transcriptional regulator | - |
MNY74_RS24775 (48495) | 48495..48641 | + | 147 | WP_157921632.1 | hypothetical protein | - |
MNY74_RS24780 (48780) | 48780..49262 | - | 483 | WP_241556897.1 | hypothetical protein | - |
MNY74_RS24785 (49365) | 49365..49700 | + | 336 | WP_050940568.1 | plasmid mobilization protein MobA | - |
MNY74_RS24790 (49784) | 49784..51718 | + | 1935 | WP_241556898.1 | relaxase/mobilization nuclease domain-containing protein | - |
MNY74_RS24795 (51829) | 51829..52032 | + | 204 | WP_097468730.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
MNY74_RS24800 (52029) | 52029..52403 | + | 375 | WP_000604347.1 | PIN domain-containing protein | Toxin |
MNY74_RS24805 (52937) | 52937..53206 | - | 270 | Protein_75 | type II toxin-antitoxin system toxin YacB | - |
MNY74_RS24810 (53206) | 53206..53475 | - | 270 | WP_097468729.1 | type II toxin-antitoxin system antitoxin YacA | - |
MNY74_RS24815 (53843) | 53843..54073 | - | 231 | Protein_77 | hypothetical protein | - |
MNY74_RS24820 (54103) | 54103..54234 | - | 132 | Protein_78 | transposase | - |
MNY74_RS25645 (55094) | 55094..55315 | + | 222 | WP_275943200.1 | PapB/FocB family fimbrial expression transcriptional regulator | - |
MNY74_RS24830 (55654) | 55654..56172 | + | 519 | WP_105289590.1 | fimbrial protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | - | faeC / faeD / faeE / faeF / faeH / faeI / faeJ / papC / papH / papH / papC | 1..118621 | 118621 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13930.35 Da Isoelectric Point: 7.3233
>T237919 WP_000604347.1 NZ_CP093240:52029-52403 [Escherichia marmotae]
MILVDTSVWVDHFKNKNDTLIQLLQSDFVLMHPMILAEIACGTPPAPRQRTLSDLDLLPKSHQATITEVLAFIENEKLFG
LGCGLVDITLLASTRITPGAKIWTLDKRLSRLAKRLNVEYQPVH
MILVDTSVWVDHFKNKNDTLIQLLQSDFVLMHPMILAEIACGTPPAPRQRTLSDLDLLPKSHQATITEVLAFIENEKLFG
LGCGLVDITLLASTRITPGAKIWTLDKRLSRLAKRLNVEYQPVH
Download Length: 375 bp
>T237919 NZ_LR883006:2788335-2788442 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 68 a.a. Molecular weight: 7369.43 Da Isoelectric Point: 4.9987
>AT237919 WP_097468730.1 NZ_CP093240:51829-52032 [Escherichia marmotae]
MRTTVTIDDALYAQALEMADPGMDKSDIFREAVKTFIRVQAAKRLASLGGTAPDMEITPRRRGDVAE
MRTTVTIDDALYAQALEMADPGMDKSDIFREAVKTFIRVQAAKRLASLGGTAPDMEITPRRRGDVAE
Download Length: 204 bp
>AT237919 NZ_LR883006:c2788285-2788222 [Escherichia coli]
TCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTAAACCTCTCAACGTGCGGGGGTTTTCT
TCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTAAACCTCTCAACGTGCGGGGGTTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|