Detailed information of TA system
Overview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 2923428..2924259 | Replicon | chromosome |
Accession | NZ_CP093221 | ||
Organism | Escherichia coli strain ER2683 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | S1P968 |
Locus tag | MNV48_RS14010 | Protein ID | WP_000854814.1 |
Coordinates | 2923428..2923802 (-) | Length | 125 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | P76364 |
Locus tag | MNV48_RS14015 | Protein ID | WP_001285584.1 |
Coordinates | 2923891..2924259 (-) | Length | 123 a.a. |
Genomic Context
Location: 2918824..2919990 (1167 bp)
Type: Others
Protein ID: WP_000830156.1
Type: Others
Protein ID: WP_000830156.1
Location: 2920109..2920582 (474 bp)
Type: Others
Protein ID: WP_001105415.1
Type: Others
Protein ID: WP_001105415.1
Location: 2920780..2921838 (1059 bp)
Type: Others
Protein ID: WP_001200891.1
Type: Others
Protein ID: WP_001200891.1
Location: 2922010..2922339 (330 bp)
Type: Others
Protein ID: WP_000450409.1
Type: Others
Protein ID: WP_000450409.1
Location: 2922694..2922822 (129 bp)
Type: Others
Protein ID: Protein_2731
Type: Others
Protein ID: Protein_2731
Location: 2922440..2922574 (135 bp)
Type: Others
Protein ID: WP_001297944.1
Type: Others
Protein ID: WP_001297944.1
Location: 2923111..2923191 (81 bp)
Type: Others
Protein ID: Protein_2732
Type: Others
Protein ID: Protein_2732
Location: 2923237..2923431 (195 bp)
Type: Others
Protein ID: WP_000988600.1
Type: Others
Protein ID: WP_000988600.1
Location: 2923428..2923802 (375 bp)
Type: Toxin
Protein ID: WP_000854814.1
Type: Toxin
Protein ID: WP_000854814.1
Location: 2923891..2924259 (369 bp)
Type: Antitoxin
Protein ID: WP_001285584.1
Type: Antitoxin
Protein ID: WP_001285584.1
Location: 2924333..2924554 (222 bp)
Type: Others
Protein ID: WP_000692323.1
Type: Others
Protein ID: WP_000692323.1
Location: 2924617..2925063 (447 bp)
Type: Others
Protein ID: WP_000187523.1
Type: Others
Protein ID: WP_000187523.1
Location: 2925060..2926592 (1533 bp)
Type: Others
Protein ID: WP_001350525.1
Type: Others
Protein ID: WP_001350525.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MNV48_RS13970 (2918824) | 2918824..2919990 | + | 1167 | WP_000830156.1 | serine-type D-Ala-D-Ala carboxypeptidase DacD | - |
MNV48_RS13975 (2920109) | 2920109..2920582 | + | 474 | WP_001105415.1 | DNA gyrase inhibitor SbmC | - |
MNV48_RS13980 (2920780) | 2920780..2921838 | + | 1059 | WP_001200891.1 | FUSC family protein | - |
MNV48_RS13985 (2922010) | 2922010..2922339 | + | 330 | WP_000450409.1 | DUF496 family protein | - |
MNV48_RS13990 (2922440) | 2922440..2922574 | - | 135 | WP_001297944.1 | EutP/PduV family microcompartment system protein | - |
MNV48_RS13995 (2922694) | 2922694..2922822 | + | 129 | Protein_2731 | transposase domain-containing protein | - |
MNV48_RS14000 (2923111) | 2923111..2923191 | - | 81 | Protein_2732 | hypothetical protein | - |
MNV48_RS14005 (2923237) | 2923237..2923431 | - | 195 | WP_000988600.1 | DUF5983 family protein | - |
MNV48_RS14010 (2923428) | 2923428..2923802 | - | 375 | WP_000854814.1 | type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA | Toxin |
MNV48_RS14015 (2923891) | 2923891..2924259 | - | 369 | WP_001285584.1 | type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA | Antitoxin |
MNV48_RS14020 (2924333) | 2924333..2924554 | - | 222 | WP_000692323.1 | DUF987 domain-containing protein | - |
MNV48_RS14025 (2924617) | 2924617..2925063 | - | 447 | WP_000187523.1 | RadC family protein | - |
MNV48_RS14030 (2925060) | 2925060..2926592 | - | 1533 | WP_001350525.1 | protein YeeR | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
No matching records found |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13898.94 Da Isoelectric Point: 7.8522
>T237832 WP_000854814.1 NZ_CP093221:c2923802-2923428 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK
Download Length: 375 bp
>T237832 NZ_LR882974:c33708-33502 [Escherichia coli]
ATGAAGTACTTGAACACTACTGATTGTAGCCTCTTCCTTGCAGAGAGGTCAAAGTTTATGACGAAATATACCCTTATTGG
GTTGCTCGCCGTGTGTGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACGGTTATGTGAACTGAATATTCACAGAG
GAAATACAGTGGTGCAGGTAACTTTGGCCTACGAAGCACGGAAGTAA
ATGAAGTACTTGAACACTACTGATTGTAGCCTCTTCCTTGCAGAGAGGTCAAAGTTTATGACGAAATATACCCTTATTGG
GTTGCTCGCCGTGTGTGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACGGTTATGTGAACTGAATATTCACAGAG
GAAATACAGTGGTGCAGGTAACTTTGGCCTACGAAGCACGGAAGTAA
Antitoxin
Download Length: 123 a.a. Molecular weight: 13651.52 Da Isoelectric Point: 5.9541
>AT237832 WP_001285584.1 NZ_CP093221:c2924259-2923891 [Escherichia coli]
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCDYVYLAVYPTPEMKN
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCDYVYLAVYPTPEMKN
Download Length: 369 bp
>AT237832 NZ_LR882974:33700-33756 [Escherichia coli]
GTACTTCATGCAGACCTCACGAGTTAATGGATTAACAAGTGGGGTCTTCGCATTTCT
GTACTTCATGCAGACCTCACGAGTTAATGGATTAACAAGTGGGGTCTTCGCATTTCT
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829FY50 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
PDB | 2H28 | |
AlphaFold DB | A0A1M2E8G6 |