Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-StbC |
Location | 1274204..1274843 | Replicon | chromosome |
Accession | NZ_CP092844 | ||
Organism | Burkholderia ambifaria strain Q53 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | MK974_RS21685 | Protein ID | WP_006753827.1 |
Coordinates | 1274427..1274843 (+) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | MK974_RS21680 | Protein ID | WP_269018413.1 |
Coordinates | 1274204..1274440 (+) | Length | 79 a.a. |
Genomic Context
Location: 1269707..1270576 (870 bp)
Type: Others
Protein ID: WP_011658910.1
Type: Others
Protein ID: WP_011658910.1
Location: 1272754..1273956 (1203 bp)
Type: Others
Protein ID: WP_269018412.1
Type: Others
Protein ID: WP_269018412.1
Location: 1274204..1274440 (237 bp)
Type: Antitoxin
Protein ID: WP_269018413.1
Type: Antitoxin
Protein ID: WP_269018413.1
Location: 1274427..1274843 (417 bp)
Type: Toxin
Protein ID: WP_006753827.1
Type: Toxin
Protein ID: WP_006753827.1
Location: 1275057..1275251 (195 bp)
Type: Others
Protein ID: WP_244098807.1
Type: Others
Protein ID: WP_244098807.1
Location: 1275535..1275738 (204 bp)
Type: Others
Protein ID: WP_006751843.1
Type: Others
Protein ID: WP_006751843.1
Location: 1276200..1276463 (264 bp)
Type: Others
Protein ID: WP_006751842.1
Type: Others
Protein ID: WP_006751842.1
Location: 1276867..1277133 (267 bp)
Type: Others
Protein ID: Protein_1134
Type: Others
Protein ID: Protein_1134
Location: 1277137..1277652 (516 bp)
Type: Others
Protein ID: WP_269018414.1
Type: Others
Protein ID: WP_269018414.1
Location: 1278214..1278462 (249 bp)
Type: Others
Protein ID: WP_175699185.1
Type: Others
Protein ID: WP_175699185.1
Location: 1271301..1272527 (1227 bp)
Type: Others
Protein ID: WP_269018411.1
Type: Others
Protein ID: WP_269018411.1
Location: 1276758..1276871 (114 bp)
Type: Others
Protein ID: Protein_1133
Type: Others
Protein ID: Protein_1133
Location: 1277663..1278076 (414 bp)
Type: Others
Protein ID: WP_269018415.1
Type: Others
Protein ID: WP_269018415.1
Location: 1278486..1279649 (1164 bp)
Type: Others
Protein ID: WP_229063860.1
Type: Others
Protein ID: WP_229063860.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MK974_RS21665 (MK974_21645) | 1269707..1270576 | + | 870 | WP_011658910.1 | LysR substrate-binding domain-containing protein | - |
MK974_RS21670 (MK974_21650) | 1271301..1272527 | - | 1227 | WP_269018411.1 | acyltransferase | - |
MK974_RS21675 (MK974_21655) | 1272754..1273956 | + | 1203 | WP_269018412.1 | glycosyltransferase family 87 protein | - |
MK974_RS21680 (MK974_21660) | 1274204..1274440 | + | 237 | WP_269018413.1 | DNA-binding protein | Antitoxin |
MK974_RS21685 (MK974_21665) | 1274427..1274843 | + | 417 | WP_006753827.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
MK974_RS21690 (MK974_21670) | 1275057..1275251 | + | 195 | WP_244098807.1 | hypothetical protein | - |
MK974_RS21695 (MK974_21675) | 1275535..1275738 | + | 204 | WP_006751843.1 | cold-shock protein | - |
MK974_RS21700 (MK974_21680) | 1276200..1276463 | + | 264 | WP_006751842.1 | translation initiation factor IF-1 | - |
MK974_RS21705 (MK974_21685) | 1276758..1276871 | - | 114 | Protein_1133 | 4-hydroxy-2-oxovalerate aldolase | - |
MK974_RS21710 (MK974_21690) | 1276867..1277133 | + | 267 | Protein_1134 | FAD-binding protein | - |
MK974_RS21715 (MK974_21695) | 1277137..1277652 | + | 516 | WP_269018414.1 | transferase hexapeptide repeat family protein | - |
MK974_RS21720 (MK974_21700) | 1277663..1278076 | - | 414 | WP_269018415.1 | hypothetical protein | - |
MK974_RS21725 (MK974_21705) | 1278214..1278462 | + | 249 | WP_175699185.1 | hypothetical protein | - |
MK974_RS21730 (MK974_21710) | 1278486..1279649 | - | 1164 | WP_229063860.1 | MFS transporter | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
No matching records found |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15295.49 Da Isoelectric Point: 6.9900
>T237252 WP_006753827.1 NZ_CP092844:1274427-1274843 [Burkholderia ambifaria]
VFLIDTNVISEIRKGKRTNRGVRAFFRQAEADASPLYLSVVTVAELRRGVDLIRHRGDHPQASALEAWMATILSGYASNI
LPVDIETAQMWGHLRVPDPAHALDHLIAATALINDLTVVTRNVDDFARTGVRLLNPFD
VFLIDTNVISEIRKGKRTNRGVRAFFRQAEADASPLYLSVVTVAELRRGVDLIRHRGDHPQASALEAWMATILSGYASNI
LPVDIETAQMWGHLRVPDPAHALDHLIAATALINDLTVVTRNVDDFARTGVRLLNPFD
Download Length: 417 bp
>T237252 NZ_LR822061:2482914-2483021 [Staphylococcus aureus]
ATGTTCAATTTATTAATTAACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
ATGTTCAATTTATTAATTAACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
Antitoxin
Download Length: 79 a.a. Molecular weight: 8633.70 Da Isoelectric Point: 6.4632
>AT237252 WP_269018413.1 NZ_CP092844:1274204-1274440 [Burkholderia ambifaria]
MANLLVRNVDDSIVQSLREQAAANGRSAEAEHRAILAAALGRPKRRTFAHVLMSMPDVGEDADFQRVQDSGEVRRVFD
MANLLVRNVDDSIVQSLREQAAANGRSAEAEHRAILAAALGRPKRRTFAHVLMSMPDVGEDADFQRVQDSGEVRRVFD
Download Length: 237 bp
>AT237252 NZ_LR822061:c2483098-2483038 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA