Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) tacT-ataR/DUF1778(antitoxin)
Location 28620..29377 Replicon plasmid pS19
Accession NZ_CP092041
Organism Salmonella enterica subsp. enterica serovar Infantis strain S19

Toxin (Protein)


Gene name tacT Uniprot ID A0A241PXX4
Locus tag MCR19_RS22790 Protein ID WP_023994162.1
Coordinates 28895..29377 (+) Length 161 a.a.

Antitoxin (Protein)


Gene name ataR Uniprot ID A0A727Z1I8
Locus tag MCR19_RS22785 Protein ID WP_001195098.1
Coordinates 28620..28904 (+) Length 95 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
MCR19_RS22740 (MCR19_22740) 24461..24607 - 147 Protein_20 IS66 family insertion sequence element accessory protein TnpB -
MCR19_RS22745 (MCR19_22745) 24594..24923 - 330 WP_023994169.1 hypothetical protein -
MCR19_RS22750 (MCR19_22750) 25047..25900 + 854 Protein_22 site-specific tyrosine recombinase XerC -
MCR19_RS22755 (MCR19_22755) 25869..26156 + 288 WP_031619580.1 damage-inducible protein J -
MCR19_RS22760 (MCR19_22760) 26153..26458 + 306 WP_023994167.1 type II toxin-antitoxin system RelE/ParE family toxin -
MCR19_RS22765 (MCR19_22765) 27208..27471 + 264 WP_023994165.1 DUF977 family protein -
MCR19_RS22770 (MCR19_22770) 27497..27832 + 336 WP_023994164.1 hypothetical protein -
MCR19_RS22775 (MCR19_22775) 28054..28251 - 198 Protein_27 PIN domain-containing protein -
MCR19_RS22780 (MCR19_22780) 28375..28464 + 90 WP_071790431.1 helix-turn-helix domain-containing protein -
MCR19_RS22785 (MCR19_22785) 28620..28904 + 285 WP_001195098.1 DUF1778 domain-containing protein Antitoxin
MCR19_RS22790 (MCR19_22790) 28895..29377 + 483 WP_023994162.1 GNAT family N-acetyltransferase Toxin
MCR19_RS22795 (MCR19_22795) 29692..30118 + 427 Protein_31 transposase -
MCR19_RS22800 (MCR19_22800) 30435..30644 + 210 WP_023994160.1 hemolysin expression modulator Hha -
MCR19_RS22805 (MCR19_22805) 30718..31070 - 353 Protein_33 transposase -
MCR19_RS22810 (MCR19_22810) 31297..32272 + 976 Protein_34 IS256 family transposase -
MCR19_RS22815 (MCR19_22815) 32274..32516 + 243 WP_023994156.1 hypothetical protein -
MCR19_RS22820 (MCR19_22820) 32587..33543 + 957 WP_023994155.1 Rpn family recombination-promoting nuclease/putative transposase -
MCR19_RS22825 (MCR19_22825) 33602..33814 + 213 WP_023994154.1 hypothetical protein -
MCR19_RS22830 (MCR19_22830) 33856..34107 - 252 WP_023994153.1 helix-turn-helix domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - faeC / faeD / faeE / faeF / faeH / faeI / fyuA / ybtE / ybtT / ybtU / irp1 / irp2 / ybtA / ybtP / ybtQ / ybtX / ybtS 1..250171 250171
- inside IScluster/Tn - - 23156..35671 12515


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

GNAT domain

(31-149)

Antitoxin

Vibrio phage ICP1, Orf50

(13-88)


Sequences

Toxin        


Download         Length: 161 a.a.        Molecular weight: 17971.54 Da        Isoelectric Point: 6.8521

>T235570 WP_023994162.1 NZ_CP092041:28895-29377 [Salmonella enterica subsp. enterica serovar Infantis]
MEISVTAPELLNEEHYLQQFDCGNDVLSDWLRRRAMKNQYLNASRTFVICPEGTKRVVGYYSIATGSVSHASLGRSLRQN
MPDPVPVVLLGRLAVDECTQGHSFGKWLLNDAVTRVSNLADQVGIKAIMVHAIDEQAKTFYEYFGFVQSPIAPNTLFYKI

Download         Length: 483 bp

>T235570 NZ_LR134305:c2190639-2190532 [Staphylococcus aureus]
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA

Antitoxin


Download         Length: 95 a.a.        Molecular weight: 10964.52 Da        Isoelectric Point: 9.6539

>AT235570 WP_001195098.1 NZ_CP092041:28620-28904 [Salmonella enterica subsp. enterica serovar Infantis]
MQTTIRKSVRNKQINIRATDEERAVIDYAASLVSKNRTDFIIEKAVSEAQNIILDQRVFVLDDARYQAFIKQLEAPVQNT
EGRQRLMDVKPEWK

Download         Length: 285 bp

>AT235570 NZ_LR134305:2190455-2190515 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A241PXX4

Antitoxin

Source ID Structure
AlphaFold DB A0A727Z1I8

References