Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 246063..246733 | Replicon | plasmid pJNQH373-1 |
Accession | NZ_CP091979 | ||
Organism | Klebsiella pneumoniae isolate JNQH373 |
Toxin (Protein)
Gene name | vagD | Uniprot ID | Q6U619 |
Locus tag | L6V94_RS27120 | Protein ID | WP_004213072.1 |
Coordinates | 246063..246506 (-) | Length | 148 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | Q6U620 |
Locus tag | L6V94_RS27125 | Protein ID | WP_004213073.1 |
Coordinates | 246503..246733 (-) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
L6V94_RS27085 (L6V94_27085) | 241475..241750 | + | 276 | WP_004213932.1 | carboxymuconolactone decarboxylase family protein | - |
L6V94_RS27090 (L6V94_27090) | 241813..242304 | + | 492 | WP_011251327.1 | DM13 domain-containing protein | - |
L6V94_RS27095 (L6V94_27095) | 242353..243273 | + | 921 | WP_004213934.1 | DUF1471 domain-containing protein | - |
L6V94_RS27100 (L6V94_27100) | 243364..243767 | + | 404 | Protein_252 | GAF domain-containing protein | - |
L6V94_RS27105 (L6V94_27105) | 244285..244919 | - | 635 | Protein_253 | mucoid phenotype regulator RmpA2 | - |
L6V94_RS27110 (L6V94_27110) | 245336..245640 | + | 305 | Protein_254 | transposase | - |
L6V94_RS27115 (L6V94_27115) | 245663..245914 | - | 252 | WP_186987481.1 | hypothetical protein | - |
L6V94_RS27120 (L6V94_27120) | 246063..246506 | - | 444 | WP_004213072.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
L6V94_RS27125 (L6V94_27125) | 246503..246733 | - | 231 | WP_004213073.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
L6V94_RS27130 (L6V94_27130) | 247341..248474 | + | 1134 | WP_004213075.1 | DUF3800 domain-containing protein | - |
L6V94_RS27135 (L6V94_27135) | 248490..248783 | + | 294 | WP_004213076.1 | hypothetical protein | - |
L6V94_RS27140 (L6V94_27140) | 248773..248979 | - | 207 | WP_004213077.1 | hypothetical protein | - |
L6V94_RS27145 (L6V94_27145) | 249331..249621 | + | 291 | WP_004213078.1 | hypothetical protein | - |
L6V94_RS27150 (L6V94_27150) | 249611..250510 | + | 900 | WP_004225022.1 | nucleotide-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Mobilizable plasmid | - | iroE / iroB / iroC / iroD / iroN / rmpA / iucA / iucB / iucC / iucD / iutA / rmpA | 1..279569 | 279569 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 148 a.a. Molecular weight: 16006.74 Da Isoelectric Point: 9.3642
>T235341 WP_004213072.1 NZ_CP091979:c246506-246063 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFERVPGLVLEDWVKKAALCRVIS
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFERVPGLVLEDWVKKAALCRVIS
Download Length: 444 bp
>T235341 NZ_LR134239:2513985-2514092 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 77 a.a. Molecular weight: 8677.73 Da Isoelectric Point: 4.4563
>AT235341 WP_004213073.1 NZ_CP091979:c246733-246503 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFDGVSELEIVREGDSIILRPVRPTWGSFAQLDRAAPDFMAEREDVVSDEGRFEP
MRTVSIFKNGNNRAIRLPRDLDFDGVSELEIVREGDSIILRPVRPTWGSFAQLDRAAPDFMAEREDVVSDEGRFEP
Download Length: 231 bp
>AT235341 NZ_LR134239:c2513938-2513872 [Escherichia coli]
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|