Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
Location | 18659..19008 | Replicon | plasmid p3_L201601331 |
Accession | NZ_CP091966 | ||
Organism | Leptospira noguchii strain 201601331 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | MAL07_RS19835 | Protein ID | WP_279574428.1 |
Coordinates | 18659..18757 (-) | Length | 33 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | - |
Locus tag | MAL07_RS19840 | Protein ID | WP_243825609.1 |
Coordinates | 18793..19008 (-) | Length | 72 a.a. |
Genomic Context
Location: 14639..14904 (266 bp)
Type: Others
Protein ID: Protein_19
Type: Others
Protein ID: Protein_19
Location: 15035..15379 (345 bp)
Type: Others
Protein ID: WP_243825608.1
Type: Others
Protein ID: WP_243825608.1
Location: 15976..16165 (190 bp)
Type: Others
Protein ID: Protein_21
Type: Others
Protein ID: Protein_21
Location: 17745..18054 (310 bp)
Type: Others
Protein ID: Protein_24
Type: Others
Protein ID: Protein_24
Location: 18020..18393 (374 bp)
Type: Others
Protein ID: Protein_25
Type: Others
Protein ID: Protein_25
Location: 21284..21502 (219 bp)
Type: Others
Protein ID: WP_243825611.1
Type: Others
Protein ID: WP_243825611.1
Location: 21439..21666 (228 bp)
Type: Others
Protein ID: WP_243825620.1
Type: Others
Protein ID: WP_243825620.1
Location: 16427..16829 (403 bp)
Type: Others
Protein ID: Protein_22
Type: Others
Protein ID: Protein_22
Location: 16839..17072 (234 bp)
Type: Others
Protein ID: Protein_23
Type: Others
Protein ID: Protein_23
Location: 18487..18612 (126 bp)
Type: Others
Protein ID: WP_243825619.1
Type: Others
Protein ID: WP_243825619.1
Location: 18659..18757 (99 bp)
Type: Toxin
Protein ID: WP_279574428.1
Type: Toxin
Protein ID: WP_279574428.1
Location: 18793..19008 (216 bp)
Type: Antitoxin
Protein ID: WP_243825609.1
Type: Antitoxin
Protein ID: WP_243825609.1
Location: 19522..19917 (396 bp)
Type: Others
Protein ID: WP_243825610.1
Type: Others
Protein ID: WP_243825610.1
Location: 20027..20518 (492 bp)
Type: Others
Protein ID: Protein_30
Type: Others
Protein ID: Protein_30
Location: 20795..21215 (421 bp)
Type: Others
Protein ID: Protein_31
Type: Others
Protein ID: Protein_31
Location: 21797..22919 (1123 bp)
Type: Others
Protein ID: Protein_34
Type: Others
Protein ID: Protein_34
Location: 22919..23254 (336 bp)
Type: Others
Protein ID: WP_243825612.1
Type: Others
Protein ID: WP_243825612.1
Location: 23534..23779 (246 bp)
Type: Others
Protein ID: WP_243825613.1
Type: Others
Protein ID: WP_243825613.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MAL07_RS19795 (MAL07_19795) | 14639..14904 | + | 266 | Protein_19 | IS5/IS1182 family transposase | - |
MAL07_RS19800 (MAL07_19800) | 15035..15379 | + | 345 | WP_243825608.1 | hypothetical protein | - |
MAL07_RS19805 (MAL07_19805) | 15976..16165 | + | 190 | Protein_21 | IS5/IS1182 family transposase | - |
MAL07_RS19810 (MAL07_19810) | 16427..16829 | - | 403 | Protein_22 | putative toxin-antitoxin system toxin component, PIN family | - |
MAL07_RS19815 (MAL07_19815) | 16839..17072 | - | 234 | Protein_23 | ribbon-helix-helix domain-containing protein | - |
MAL07_RS19820 (MAL07_19820) | 17745..18054 | + | 310 | Protein_24 | hypothetical protein | - |
MAL07_RS19825 (MAL07_19825) | 18020..18393 | + | 374 | Protein_25 | hypothetical protein | - |
MAL07_RS19830 (MAL07_19830) | 18487..18612 | - | 126 | WP_243825619.1 | toxin-antitoxin system, toxin component, MazF family protein | - |
MAL07_RS19835 (MAL07_19835) | 18659..18757 | - | 99 | WP_279574428.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
MAL07_RS19840 (MAL07_19840) | 18793..19008 | - | 216 | WP_243825609.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
MAL07_RS19845 (MAL07_19845) | 19522..19917 | - | 396 | WP_243825610.1 | hypothetical protein | - |
MAL07_RS19850 (MAL07_19850) | 20027..20518 | - | 492 | Protein_30 | PD-(D/E)XK nuclease family protein | - |
MAL07_RS19855 (MAL07_19855) | 20795..21215 | - | 421 | Protein_31 | XRE family transcriptional regulator | - |
MAL07_RS19860 (MAL07_19860) | 21284..21502 | + | 219 | WP_243825611.1 | hypothetical protein | - |
MAL07_RS19865 (MAL07_19865) | 21439..21666 | + | 228 | WP_243825620.1 | helix-turn-helix transcriptional regulator | - |
MAL07_RS19870 (MAL07_19870) | 21797..22919 | - | 1123 | Protein_34 | restriction endonuclease | - |
MAL07_RS19875 (MAL07_19875) | 22919..23254 | - | 336 | WP_243825612.1 | hypothetical protein | - |
MAL07_RS19880 (MAL07_19880) | 23534..23779 | - | 246 | WP_243825613.1 | DNA methyltransferase | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..28484 | 28484 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 33 a.a. Molecular weight: 3610.09 Da Isoelectric Point: 10.6262
>T235294 WP_279574428.1 NZ_CP091966:c18757-18659 [Leptospira noguchii]
VWLNFTPQAGHEQKGRRPALVLSPKEYNSKTG
VWLNFTPQAGHEQKGRRPALVLSPKEYNSKTG
Download Length: 99 bp
>T235294 NZ_LR134236:2070122-2070225 [Escherichia coli]
GGCAAGGCAACTAAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATAC
AGGAATCGTGTTCGGTCTCTTTTT
GGCAAGGCAACTAAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATAC
AGGAATCGTGTTCGGTCTCTTTTT
Antitoxin
Download Length: 72 a.a. Molecular weight: 7843.92 Da Isoelectric Point: 5.6422
>AT235294 WP_243825609.1 NZ_CP091966:c19008-18793 [Leptospira noguchii]
MGNSLGIRIPKAMATELELNDGSHVELQYEGDKIVIYPMKKASLEDKLSKITKQNLHSEISTGNSIGNEAW
MGNSLGIRIPKAMATELELNDGSHVELQYEGDKIVIYPMKKASLEDKLSKITKQNLHSEISTGNSIGNEAW
Download Length: 216 bp
>AT235294 NZ_LR134236:c2070263-2069992 [Escherichia coli]
AAAGTCAGCGAAGGAAATGCTTCTGGCTTTTAACAGATAAAAAGAGACCGAACACGATTCCTGTATTCGGTCCAGGGAAA
TGGCTCTTGGGAGAGAGCCGTGCGCTAAAAGTTGGCATTAATGCAGGCTTAGTTGCCTTGCCCTTTAAGAATAGATGACG
ACGCCAGGTTTTCCAGTTTGCGTGCAAAATGGTCAATAAAAAGCGCGGTGGTCATCAGCTTAAATGTTAAAAACCGCCCG
TTCTGGTGAAAGAACTGAGGCGGTTTTTTTAT
AAAGTCAGCGAAGGAAATGCTTCTGGCTTTTAACAGATAAAAAGAGACCGAACACGATTCCTGTATTCGGTCCAGGGAAA
TGGCTCTTGGGAGAGAGCCGTGCGCTAAAAGTTGGCATTAATGCAGGCTTAGTTGCCTTGCCCTTTAAGAATAGATGACG
ACGCCAGGTTTTCCAGTTTGCGTGCAAAATGGTCAATAAAAAGCGCGGTGGTCATCAGCTTAAATGTTAAAAACCGCCCG
TTCTGGTGAAAGAACTGAGGCGGTTTTTTTAT