Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | chpIK/PemK(toxin) |
Location | 750469..751045 | Replicon | chromosome |
Accession | NZ_CP091953 | ||
Organism | Leptospira noguchii strain IP1605021 |
Toxin (Protein)
Gene name | chpK | Uniprot ID | - |
Locus tag | MAL09_RS03265 | Protein ID | WP_002155521.1 |
Coordinates | 750469..750810 (-) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | chpI | Uniprot ID | M6U786 |
Locus tag | MAL09_RS03270 | Protein ID | WP_004425715.1 |
Coordinates | 750797..751045 (-) | Length | 83 a.a. |
Genomic Context
Location: 746970..748844 (1875 bp)
Type: Others
Protein ID: WP_141598266.1
Type: Others
Protein ID: WP_141598266.1
Location: 745478..745813 (336 bp)
Type: Others
Protein ID: WP_141598265.1
Type: Others
Protein ID: WP_141598265.1
Location: 745810..746088 (279 bp)
Type: Others
Protein ID: WP_002155541.1
Type: Others
Protein ID: WP_002155541.1
Location: 746490..746615 (126 bp)
Type: Others
Protein ID: WP_279577842.1
Type: Others
Protein ID: WP_279577842.1
Location: 750469..750810 (342 bp)
Type: Toxin
Protein ID: WP_002155521.1
Type: Toxin
Protein ID: WP_002155521.1
Location: 750797..751045 (249 bp)
Type: Antitoxin
Protein ID: WP_004425715.1
Type: Antitoxin
Protein ID: WP_004425715.1
Location: 751299..751571 (273 bp)
Type: Others
Protein ID: WP_135686010.1
Type: Others
Protein ID: WP_135686010.1
Location: 751558..751857 (300 bp)
Type: Others
Protein ID: WP_141598267.1
Type: Others
Protein ID: WP_141598267.1
Location: 752182..752583 (402 bp)
Type: Others
Protein ID: WP_141598268.1
Type: Others
Protein ID: WP_141598268.1
Location: 752583..752813 (231 bp)
Type: Others
Protein ID: WP_002998826.1
Type: Others
Protein ID: WP_002998826.1
Location: 753087..753443 (357 bp)
Type: Others
Protein ID: WP_141598270.1
Type: Others
Protein ID: WP_141598270.1
Location: 753440..753700 (261 bp)
Type: Others
Protein ID: WP_002178286.1
Type: Others
Protein ID: WP_002178286.1
Location: 753966..754355 (390 bp)
Type: Others
Protein ID: WP_141598271.1
Type: Others
Protein ID: WP_141598271.1
Location: 754352..754663 (312 bp)
Type: Others
Protein ID: WP_141598272.1
Type: Others
Protein ID: WP_141598272.1
Location: 754957..755961 (1005 bp)
Type: Others
Protein ID: WP_141598273.1
Type: Others
Protein ID: WP_141598273.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MAL09_RS03250 (MAL09_03250) | 745478..745813 | - | 336 | WP_141598265.1 | VOC family protein | - |
MAL09_RS03255 (MAL09_03255) | 745810..746088 | - | 279 | WP_002155541.1 | GNAT family N-acetyltransferase | - |
MAL09_RS22290 | 746490..746615 | - | 126 | WP_279577842.1 | hypothetical protein | - |
MAL09_RS03260 (MAL09_03260) | 746970..748844 | + | 1875 | WP_141598266.1 | ATP-dependent DNA helicase RecQ | - |
MAL09_RS03265 (MAL09_03265) | 750469..750810 | - | 342 | WP_002155521.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
MAL09_RS03270 (MAL09_03270) | 750797..751045 | - | 249 | WP_004425715.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
MAL09_RS03275 (MAL09_03275) | 751299..751571 | - | 273 | WP_135686010.1 | BrnA antitoxin family protein | - |
MAL09_RS03280 (MAL09_03280) | 751558..751857 | - | 300 | WP_141598267.1 | BrnT family toxin | - |
MAL09_RS03285 (MAL09_03285) | 752182..752583 | - | 402 | WP_141598268.1 | type II toxin-antitoxin system VapC family toxin | - |
MAL09_RS03290 (MAL09_03290) | 752583..752813 | - | 231 | WP_002998826.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | - |
MAL09_RS03295 (MAL09_03295) | 753087..753443 | - | 357 | WP_141598270.1 | type II toxin-antitoxin system HicB family antitoxin | - |
MAL09_RS03300 (MAL09_03300) | 753440..753700 | - | 261 | WP_002178286.1 | type II toxin-antitoxin system HicA family toxin | - |
MAL09_RS03305 (MAL09_03305) | 753966..754355 | - | 390 | WP_141598271.1 | type II toxin-antitoxin system MqsA family antitoxin | - |
MAL09_RS03310 (MAL09_03310) | 754352..754663 | - | 312 | WP_141598272.1 | type II toxin-antitoxin system MqsR family toxin | - |
MAL09_RS03315 (MAL09_03315) | 754957..755961 | - | 1005 | WP_141598273.1 | DUF2971 domain-containing protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
No matching records found |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12329.22 Da Isoelectric Point: 9.8437
>T235283 WP_002155521.1 NZ_CP091953:c750810-750469 [Leptospira noguchii]
MIRGEIWWVDLGIPFGSEPGFKRPVLIIQDDSFNQSSISTVVSIAITSNLNLSEAPGNVLISKKESSLSKDSVVNVSQIV
TLDKERFIKRAGKLKSSKINEVETGLKLVTGLN
MIRGEIWWVDLGIPFGSEPGFKRPVLIIQDDSFNQSSISTVVSIAITSNLNLSEAPGNVLISKKESSLSKDSVVNVSQIV
TLDKERFIKRAGKLKSSKINEVETGLKLVTGLN
Download Length: 342 bp
>T235283 NZ_LR134236:184220-184327 [Escherichia coli]
ATGACGCTCGCAGAACTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
ATGACGCTCGCAGAACTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
Antitoxin
Download Length: 83 a.a. Molecular weight: 9337.83 Da Isoelectric Point: 10.3019
>AT235283 WP_004425715.1 NZ_CP091953:c751045-750797 [Leptospira noguchii]
MKTAISIPDELFKTAEKIAKKLGIPRSQLFAKALEEFIQSHSKESITEKLNKVYSNKSKELKSNIVDLSVESLRKSLKND
SW
MKTAISIPDELFKTAEKIAKKLGIPRSQLFAKALEEFIQSHSKESITEKLNKVYSNKSKELKSNIVDLSVESLRKSLKND
SW
Download Length: 249 bp
>AT235283 NZ_LR134236:c184163-184106 [Escherichia coli]
TCAAGAATGGCCCCCGTGATGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT
TCAAGAATGGCCCCCGTGATGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
No matching records found |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | M6U786 |