Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 147012..147538 | Replicon | chromosome |
| Accession | NZ_CP091652 | ||
| Organism | Escherichia coli strain KMi025 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | S1EXL1 |
| Locus tag | L6L63_RS00735 | Protein ID | WP_000323025.1 |
| Coordinates | 147251..147538 (+) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | S1F6D3 |
| Locus tag | L6L63_RS00730 | Protein ID | WP_000534858.1 |
| Coordinates | 147012..147251 (+) | Length | 80 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| L6L63_RS00695 (142740) | 142740..142970 | - | 231 | Protein_135 | IS66 family insertion sequence element accessory protein TnpB | - |
| L6L63_RS00700 (142976) | 142976..143098 | - | 123 | Protein_136 | transposase | - |
| L6L63_RS00705 (143341) | 143341..143762 | + | 422 | Protein_137 | hypothetical protein | - |
| L6L63_RS00710 (144418) | 144418..145440 | + | 1023 | Protein_138 | ISNCY family transposase | - |
| L6L63_RS00715 (145561) | 145561..145710 | + | 150 | WP_011443592.1 | protein YdfW | - |
| L6L63_RS00720 (146147) | 146147..146479 | - | 333 | WP_001301033.1 | FlxA-like family protein | - |
| L6L63_RS00725 (146682) | 146682..146987 | - | 306 | WP_001326990.1 | protein YdfV | - |
| L6L63_RS00730 (147012) | 147012..147251 | + | 240 | WP_000534858.1 | type II toxin-antitoxin system antitoxin RelB | Antitoxin |
| L6L63_RS00735 (147251) | 147251..147538 | + | 288 | WP_000323025.1 | type II toxin-antitoxin system mRNA interferase RelE | Toxin |
| L6L63_RS00740 (147610) | 147610..147765 | + | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | - |
| L6L63_RS00745 (147982) | 147982..148233 | + | 252 | WP_000980994.1 | protein Rem | - |
| L6L63_RS00750 (148300) | 148300..148578 | + | 279 | WP_012304870.1 | hypothetical protein | - |
| L6L63_RS00755 (148580) | 148580..149629 | + | 1050 | WP_001265199.1 | DUF968 domain-containing protein | - |
| L6L63_RS00760 (149643) | 149643..150395 | + | 753 | WP_001047135.1 | antitermination protein | - |
| L6L63_RS00765 (150673) | 150673..150762 | - | 90 | WP_120795389.1 | hypothetical protein | - |
| L6L63_RS00770 (150817) | 150817..151029 | - | 213 | WP_000087756.1 | cold shock-like protein CspF | - |
| L6L63_RS00775 (151330) | 151330..151545 | + | 216 | WP_000066484.1 | cold shock-like protein CspB | - |
| L6L63_RS00780 (151909) | 151909..152079 | - | 171 | WP_211180497.1 | putative zinc-binding protein YnfU | - |
| L6L63_RS00785 (152299) | 152299..152514 | + | 216 | WP_000839590.1 | phage lysis protein EssD | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 132191..178923 | 46732 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11225.22 Da Isoelectric Point: 10.1967
>T234252 WP_000323025.1 NZ_CP091652:147251-147538 [Escherichia coli]
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
Download Length: 288 bp
>T234252 NZ_LR027878:c2424257-2424153 [Staphylococcus aureus]
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTTATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTTATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
Antitoxin
Download Length: 80 a.a. Molecular weight: 9071.48 Da Isoelectric Point: 4.5230
>AT234252 WP_000534858.1 NZ_CP091652:147012-147251 [Escherichia coli]
MGSINLRIDDELKARSYAALEKMGVTPSEALRLMLEYIADNERLPFKQTLLSDEDAELVEIVKERLRNPKPVRVTLDEL
MGSINLRIDDELKARSYAALEKMGVTPSEALRLMLEYIADNERLPFKQTLLSDEDAELVEIVKERLRNPKPVRVTLDEL
Download Length: 240 bp
>AT234252 NZ_LR027878:2424040-2424095 [Staphylococcus aureus]
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|