Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3577608..3578228 | Replicon | chromosome |
Accession | NZ_CP091544 | ||
Organism | Salmonella enterica strain 1618 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | V1H8E6 |
Locus tag | L4414_RS17760 | Protein ID | WP_001280991.1 |
Coordinates | 3578010..3578228 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | V1H4V6 |
Locus tag | L4414_RS17755 | Protein ID | WP_000344807.1 |
Coordinates | 3577608..3577982 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
L4414_RS17745 (3572747) | 3572747..3573940 | + | 1194 | WP_001039202.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
L4414_RS17750 (3573963) | 3573963..3577112 | + | 3150 | WP_001132508.1 | efflux RND transporter permease AcrB | - |
L4414_RS17755 (3577608) | 3577608..3577982 | + | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
L4414_RS17760 (3578010) | 3578010..3578228 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
L4414_RS17765 (3578407) | 3578407..3578958 | + | 552 | WP_001278792.1 | maltose O-acetyltransferase | - |
L4414_RS17770 (3579075) | 3579075..3579545 | + | 471 | WP_000136181.1 | YlaC family protein | - |
L4414_RS17775 (3579601) | 3579601..3579741 | - | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
L4414_RS17780 (3579747) | 3579747..3580007 | - | 261 | WP_000801415.1 | type B 50S ribosomal protein L31 | - |
L4414_RS17785 (3580232) | 3580232..3581782 | + | 1551 | WP_000213139.1 | EAL domain-containing protein | - |
L4414_RS17795 (3582013) | 3582013..3582402 | + | 390 | WP_000961285.1 | MGMT family protein | - |
L4414_RS17800 (3582435) | 3582435..3583004 | - | 570 | WP_000779803.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T233638 WP_001280991.1 NZ_CP091544:3578010-3578228 [Salmonella enterica]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT233638 WP_000344807.1 NZ_CP091544:3577608-3577982 [Salmonella enterica]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|