Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
| Location | 2136012..2136650 | Replicon | chromosome |
| Accession | NZ_CP091427 | ||
| Organism | Escherichia coli strain 1000C-3 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | A0A0A6TXU8 |
| Locus tag | L3Z43_RS10295 | Protein ID | WP_001447010.1 |
| Coordinates | 2136012..2136188 (+) | Length | 59 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | L3Z43_RS10300 | Protein ID | WP_001270286.1 |
| Coordinates | 2136234..2136650 (+) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| L3Z43_RS10275 (2131631) | 2131631..2132806 | - | 1176 | WP_001236265.1 | BenE family transporter YdcO | - |
| L3Z43_RS10280 (2132898) | 2132898..2133434 | + | 537 | WP_000429155.1 | DNA-binding transcriptional regulator SutR | - |
| L3Z43_RS10285 (2133507) | 2133507..2135468 | + | 1962 | WP_001303492.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
| L3Z43_RS10290 (2135560) | 2135560..2135790 | - | 231 | WP_000494244.1 | YncJ family protein | - |
| L3Z43_RS10295 (2136012) | 2136012..2136188 | + | 177 | WP_001447010.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
| L3Z43_RS10300 (2136234) | 2136234..2136650 | + | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
| L3Z43_RS10305 (2136729) | 2136729..2138135 | + | 1407 | WP_000760626.1 | PLP-dependent aminotransferase family protein | - |
| L3Z43_RS10310 (2138380) | 2138380..2139525 | + | 1146 | WP_000047424.1 | ABC transporter substrate-binding protein | - |
| L3Z43_RS10315 (2139543) | 2139543..2140556 | + | 1014 | WP_000220396.1 | ABC transporter ATP-binding protein | - |
| L3Z43_RS10320 (2140557) | 2140557..2141498 | + | 942 | WP_001251304.1 | ABC transporter permease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6779.86 Da Isoelectric Point: 11.2298
>T233310 WP_001447010.1 NZ_CP091427:2136012-2136188 [Escherichia coli]
VKQSEFRRWLESQGVDVANSSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANSSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT233310 WP_001270286.1 NZ_CP091427:2136234-2136650 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|