Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/RHH(antitoxin) |
| Location | 2507093..2507653 | Replicon | chromosome |
| Accession | NZ_CP091424 | ||
| Organism | Methylobacter sp. YRD-M1 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | LZ558_RS10995 | Protein ID | WP_268116989.1 |
| Coordinates | 2507363..2507653 (+) | Length | 97 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | LZ558_RS10990 | Protein ID | WP_268116988.1 |
| Coordinates | 2507093..2507290 (+) | Length | 66 a.a. |
Genomic Context
Location: 2502899..2503688 (790 bp)
Type: Others
Protein ID: WP_268116984.1
Type: Others
Protein ID: WP_268116984.1
Location: 2507093..2507290 (198 bp)
Type: Antitoxin
Protein ID: WP_268116988.1
Type: Antitoxin
Protein ID: WP_268116988.1
Location: 2507363..2507653 (291 bp)
Type: Toxin
Protein ID: WP_268116989.1
Type: Toxin
Protein ID: WP_268116989.1
Location: 2509241..2509630 (390 bp)
Type: Others
Protein ID: WP_268116992.1
Type: Others
Protein ID: WP_268116992.1
Location: 2503816..2504148 (333 bp)
Type: Others
Protein ID: WP_268116985.1
Type: Others
Protein ID: WP_268116985.1
Location: 2504179..2505861 (1683 bp)
Type: Others
Protein ID: WP_268116986.1
Type: Others
Protein ID: WP_268116986.1
Location: 2506040..2506654 (615 bp)
Type: Others
Protein ID: WP_268116987.1
Type: Others
Protein ID: WP_268116987.1
Location: 2507876..2508514 (639 bp)
Type: Others
Protein ID: WP_268116990.1
Type: Others
Protein ID: WP_268116990.1
Location: 2508537..2509109 (573 bp)
Type: Others
Protein ID: WP_268116991.1
Type: Others
Protein ID: WP_268116991.1
Location: 2509961..2511511 (1551 bp)
Type: Others
Protein ID: WP_268116993.1
Type: Others
Protein ID: WP_268116993.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LZ558_RS10970 (LZ558_10935) | 2502899..2503688 | + | 790 | WP_268116984.1 | IS5 family transposase | - |
| LZ558_RS10975 (LZ558_10940) | 2503816..2504148 | - | 333 | WP_268116985.1 | hypothetical protein | - |
| LZ558_RS10980 (LZ558_10945) | 2504179..2505861 | - | 1683 | WP_268116986.1 | cation:proton antiporter | - |
| LZ558_RS10985 (LZ558_10950) | 2506040..2506654 | - | 615 | WP_268116987.1 | recombinase family protein | - |
| LZ558_RS10990 (LZ558_10955) | 2507093..2507290 | + | 198 | WP_268116988.1 | ribbon-helix-helix protein, CopG family | Antitoxin |
| LZ558_RS10995 (LZ558_10960) | 2507363..2507653 | + | 291 | WP_268116989.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| LZ558_RS11000 (LZ558_10965) | 2507876..2508514 | - | 639 | WP_268116990.1 | pyridoxamine 5'-phosphate oxidase family protein | - |
| LZ558_RS11005 (LZ558_10970) | 2508537..2509109 | - | 573 | WP_268116991.1 | TetR/AcrR family transcriptional regulator | - |
| LZ558_RS11010 (LZ558_10975) | 2509241..2509630 | + | 390 | WP_268116992.1 | hypothetical protein | - |
| LZ558_RS11015 (LZ558_10980) | 2509961..2511511 | - | 1551 | WP_268116993.1 | serine/threonine-protein kinase | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| No matching records found | |||||||
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 97 a.a. Molecular weight: 10677.16 Da Isoelectric Point: 6.2164
>T233299 WP_268116989.1 NZ_CP091424:2507363-2507653 [Methylobacter sp. YRD-M1]
VIVTARAAQSLEHCRRFLTEKNPQALMRAGQAIASRFSLLETEPGIGRPLDELPELRELIIPFGDSGYVALYHVDASADA
VYVLAFRHQKEAGYYS
VIVTARAAQSLEHCRRFLTEKNPQALMRAGQAIASRFSLLETEPGIGRPLDELPELRELIIPFGDSGYVALYHVDASADA
VYVLAFRHQKEAGYYS
Download Length: 291 bp
>T233299 NZ_HG738867:c1157513-1157406 [Escherichia coli str. K-12 substr. MC4100]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 66 a.a. Molecular weight: 7760.91 Da Isoelectric Point: 11.0383
>AT233299 WP_268116988.1 NZ_CP091424:2507093-2507290 [Methylobacter sp. YRD-M1]
MATSVKLDDDLKNRIQHLAEMRHRSAHWIMREAIRDYVEREGKRGKLSNRRPWHPGQLIKKPDST
MATSVKLDDDLKNRIQHLAEMRHRSAHWIMREAIRDYVEREGKRGKLSNRRPWHPGQLIKKPDST
Download Length: 198 bp
>AT233299 NZ_HG738867:1157560-1157626 [Escherichia coli str. K-12 substr. MC4100]
TGTCTGGTTTCAAGATTAGCCCCCGTTTTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT
TGTCTGGTTTCAAGATTAGCCCCCGTTTTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT