Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VapB |
| Location | 994953..995518 | Replicon | chromosome |
| Accession | NZ_CP091424 | ||
| Organism | Methylobacter sp. YRD-M1 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | LZ558_RS04505 | Protein ID | WP_268119644.1 |
| Coordinates | 995147..995518 (+) | Length | 124 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | LZ558_RS04500 | Protein ID | WP_268119643.1 |
| Coordinates | 994953..995150 (+) | Length | 66 a.a. |
Genomic Context
Location: 990987..991490 (504 bp)
Type: Others
Protein ID: WP_268119637.1
Type: Others
Protein ID: WP_268119637.1
Location: 994164..994406 (243 bp)
Type: Others
Protein ID: WP_268119640.1
Type: Others
Protein ID: WP_268119640.1
Location: 994399..994791 (393 bp)
Type: Others
Protein ID: WP_268119641.1
Type: Others
Protein ID: WP_268119641.1
Location: 994953..995150 (198 bp)
Type: Antitoxin
Protein ID: WP_268119643.1
Type: Antitoxin
Protein ID: WP_268119643.1
Location: 995147..995518 (372 bp)
Type: Toxin
Protein ID: WP_268119644.1
Type: Toxin
Protein ID: WP_268119644.1
Location: 996954..997367 (414 bp)
Type: Others
Protein ID: WP_268119646.1
Type: Others
Protein ID: WP_268119646.1
Location: 998121..998312 (192 bp)
Type: Others
Protein ID: WP_268119648.1
Type: Others
Protein ID: WP_268119648.1
Location: 998342..999040 (699 bp)
Type: Others
Protein ID: WP_268119649.1
Type: Others
Protein ID: WP_268119649.1
Location: 991529..993037 (1509 bp)
Type: Others
Protein ID: WP_268119639.1
Type: Others
Protein ID: WP_268119639.1
Location: 993286..993576 (291 bp)
Type: Others
Protein ID: Protein_887
Type: Others
Protein ID: Protein_887
Location: 993568..993693 (126 bp)
Type: Others
Protein ID: Protein_888
Type: Others
Protein ID: Protein_888
Location: 995655..996176 (522 bp)
Type: Others
Protein ID: WP_268119645.1
Type: Others
Protein ID: WP_268119645.1
Location: 997401..998000 (600 bp)
Type: Others
Protein ID: WP_268119647.1
Type: Others
Protein ID: WP_268119647.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LZ558_RS04470 (LZ558_04445) | 990987..991490 | + | 504 | WP_268119637.1 | CinA family protein | - |
| LZ558_RS04475 (LZ558_04450) | 991529..993037 | - | 1509 | WP_268119639.1 | hypothetical protein | - |
| LZ558_RS04480 (LZ558_04455) | 993286..993576 | - | 291 | Protein_887 | pilin | - |
| LZ558_RS04485 (LZ558_04460) | 993568..993693 | - | 126 | Protein_888 | prepilin-type N-terminal cleavage/methylation domain-containing protein | - |
| LZ558_RS04490 (LZ558_04465) | 994164..994406 | + | 243 | WP_268119640.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | - |
| LZ558_RS04495 (LZ558_04470) | 994399..994791 | + | 393 | WP_268119641.1 | type II toxin-antitoxin system VapC family toxin | - |
| LZ558_RS04500 (LZ558_04475) | 994953..995150 | + | 198 | WP_268119643.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| LZ558_RS04505 (LZ558_04480) | 995147..995518 | + | 372 | WP_268119644.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| LZ558_RS04510 (LZ558_04485) | 995655..996176 | - | 522 | WP_268119645.1 | DUF1264 domain-containing protein | - |
| LZ558_RS04515 (LZ558_04490) | 996954..997367 | + | 414 | WP_268119646.1 | hypothetical protein | - |
| LZ558_RS04520 (LZ558_04495) | 997401..998000 | - | 600 | WP_268119647.1 | hypothetical protein | - |
| LZ558_RS04525 (LZ558_04500) | 998121..998312 | + | 192 | WP_268119648.1 | hypothetical protein | - |
| LZ558_RS04530 (LZ558_04505) | 998342..999040 | + | 699 | WP_268119649.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| No matching records found | |||||||
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 124 a.a. Molecular weight: 13672.99 Da Isoelectric Point: 6.6400
>T233298 WP_268119644.1 NZ_CP091424:995147-995518 [Methylobacter sp. YRD-M1]
MILVDTSVWIDHLRRKDAELAAMLSEGQVLVHPWIIGELACGNLQDRKLVLDLLQSLPSASVASTGEVLFFIEKHVLMGR
GIGYVDVHLLAAARLAGTRLWTRDKRLVVVADELGMAYTETRH
MILVDTSVWIDHLRRKDAELAAMLSEGQVLVHPWIIGELACGNLQDRKLVLDLLQSLPSASVASTGEVLFFIEKHVLMGR
GIGYVDVHLLAAARLAGTRLWTRDKRLVVVADELGMAYTETRH
Download Length: 372 bp
>T233298 NZ_HG738867:c1156978-1156871 [Escherichia coli str. K-12 substr. MC4100]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 66 a.a. Molecular weight: 7349.40 Da Isoelectric Point: 11.0917
>AT233298 WP_268119643.1 NZ_CP091424:994953-995150 [Methylobacter sp. YRD-M1]
MRTTINIDDELLAQAQQLSGLTERTQLIREALRALVQRESARRLAQLGGTQPELKPVPRRQDINA
MRTTINIDDELLAQAQQLSGLTERTQLIREALRALVQRESARRLAQLGGTQPELKPVPRRQDINA
Download Length: 198 bp
>AT233298 NZ_HG738867:1157025-1157091 [Escherichia coli str. K-12 substr. MC4100]
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT