Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicA-HicB |
Location | 933593..934272 | Replicon | chromosome |
Accession | NZ_CP091362 | ||
Organism | Acinetobacter baumannii strain AB176-VUB |
Toxin (Protein)
Gene name | hicA | Uniprot ID | S3TWT7 |
Locus tag | L2Z12_RS04415 | Protein ID | WP_000838146.1 |
Coordinates | 934090..934272 (-) | Length | 61 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | N9L2H6 |
Locus tag | L2Z12_RS04410 | Protein ID | WP_000966688.1 |
Coordinates | 933593..933997 (-) | Length | 135 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
L2Z12_RS04375 (L2Z12_04370) | 928886..929401 | - | 516 | WP_001056868.1 | Rha family transcriptional regulator | - |
L2Z12_RS04380 (L2Z12_04375) | 929742..930677 | - | 936 | WP_000254125.1 | ORF6N domain-containing protein | - |
L2Z12_RS04385 (L2Z12_04380) | 930827..931093 | + | 267 | WP_000774879.1 | hypothetical protein | - |
L2Z12_RS04390 (L2Z12_04385) | 931136..931627 | - | 492 | WP_000755583.1 | DUF4468 domain-containing protein | - |
L2Z12_RS04395 (L2Z12_04390) | 931713..932459 | - | 747 | WP_000599537.1 | hypothetical protein | - |
L2Z12_RS04400 (L2Z12_04395) | 932521..932904 | - | 384 | WP_000725052.1 | hypothetical protein | - |
L2Z12_RS04405 (L2Z12_04400) | 932969..933493 | - | 525 | WP_000721574.1 | DUF4468 domain-containing protein | - |
L2Z12_RS04410 (L2Z12_04405) | 933593..933997 | - | 405 | WP_000966688.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
L2Z12_RS04415 (L2Z12_04410) | 934090..934272 | - | 183 | WP_000838146.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
L2Z12_RS04420 (L2Z12_04415) | 934598..935113 | - | 516 | WP_138147038.1 | hypothetical protein | - |
L2Z12_RS04425 (L2Z12_04420) | 935183..936100 | - | 918 | WP_000094273.1 | phage tail tube protein | - |
L2Z12_RS04430 (L2Z12_04425) | 936153..937457 | - | 1305 | WP_032038814.1 | pyocin knob domain-containing protein | - |
L2Z12_RS04435 (L2Z12_04430) | 937457..937810 | - | 354 | WP_000064603.1 | hypothetical protein | - |
L2Z12_RS04440 (L2Z12_04435) | 937907..938428 | - | 522 | WP_215748175.1 | SH3 domain-containing protein | - |
L2Z12_RS04445 (L2Z12_04440) | 938537..938755 | - | 219 | WP_001277696.1 | hypothetical protein | - |
L2Z12_RS04450 (L2Z12_04445) | 938757..939200 | - | 444 | WP_002016455.1 | phage tail terminator-like protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | blaADC-25 | basJ / basI / basI / basH / barB / barA / basG / basF / entE / basD / basC / bauA / bauB / bauE | 916500..1008084 | 91584 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6695.84 Da Isoelectric Point: 10.5523
>T233241 WP_000838146.1 NZ_CP091362:c934272-934090 [Acinetobacter baumannii]
VKSLDLIKMIEADGWYEVRVSGSHHHFKHPTKKGLVTIPHPKKDLPNGTVKSILKQAGLN
VKSLDLIKMIEADGWYEVRVSGSHHHFKHPTKKGLVTIPHPKKDLPNGTVKSILKQAGLN
Download Length: 183 bp
>T233241 NZ_HF571988:2133003-2133097 [Yersinia enterocolitica (type O:5) str. YE53/03]
AACAAGCCTACGTTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTAGACCGAATATAGGAATCGT
ATTCGGTCTATTTTT
AACAAGCCTACGTTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTAGACCGAATATAGGAATCGT
ATTCGGTCTATTTTT
Antitoxin
Download Length: 135 a.a. Molecular weight: 14647.69 Da Isoelectric Point: 4.4328
>AT233241 WP_000966688.1 NZ_CP091362:c933997-933593 [Acinetobacter baumannii]
MLYPIAIERGSDTEAFGVTVPDIPGCFSAGDTLEEAIENVKEAISGHLEILAEDGEEIPLASELVKFVDDPEYKGMIWAV
TEVDVSRYLGKPEKINVTLPSRLIRKIDENVGKGKRYTTRSAFLAAGAEKLLHA
MLYPIAIERGSDTEAFGVTVPDIPGCFSAGDTLEEAIENVKEAISGHLEILAEDGEEIPLASELVKFVDDPEYKGMIWAV
TEVDVSRYLGKPEKINVTLPSRLIRKIDENVGKGKRYTTRSAFLAAGAEKLLHA
Download Length: 405 bp
>AT233241 NZ_HF571988:c2133098-2132981 [Yersinia enterocolitica (type O:5) str. YE53/03]
TAAAAATAGACCGAATACGATTCCTATATTCGGTCTAGGGAAATGGCTCTTGGGAGAGAGCCGTGCGCTAAAAGTTGGCA
TTAACGTAGGCTTGTTCAGCCATACTCTTTAAGAGTAG
TAAAAATAGACCGAATACGATTCCTATATTCGGTCTAGGGAAATGGCTCTTGGGAGAGAGCCGTGCGCTAAAAGTTGGCA
TTAACGTAGGCTTGTTCAGCCATACTCTTTAAGAGTAG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|