233236

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) BrnTA/BrnT-BrnA
Location 955894..956482 Replicon chromosome
Accession NZ_CP091361
Organism Acinetobacter baumannii strain AB177-VUB

Toxin (Protein)


Gene name brnT Uniprot ID N8SM64
Locus tag L2Z13_RS04685 Protein ID WP_000438825.1
Coordinates 956195..956482 (-) Length 96 a.a.

Antitoxin (Protein)


Gene name brnA Uniprot ID D3JXQ4
Locus tag L2Z13_RS04680 Protein ID WP_004728120.1
Coordinates 955894..956208 (-) Length 105 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
L2Z13_RS04645 (L2Z13_04645) 951123..951470 - 348 Protein_927 IS4 family transposase -
L2Z13_RS04650 (L2Z13_04650) 951560..952375 + 816 WP_001043260.1 sulfonamide-resistant dihydropteroate synthase Sul2 -
L2Z13_RS04655 (L2Z13_04655) 952462..952764 + 303 WP_000251875.1 phosphoglucosamine mutase -
L2Z13_RS04660 (L2Z13_04660) 952940..953770 - 831 Protein_930 IS91-like element ISVsa3 family transposase -
L2Z13_RS04665 (L2Z13_04665) 953834..954538 + 705 WP_071543226.1 IS6-like element IS1006 family transposase -
L2Z13_RS04670 (L2Z13_04670) 954666..955004 - 339 WP_032073153.1 hypothetical protein -
L2Z13_RS04675 (L2Z13_04675) 955063..955833 + 771 WP_032073134.1 hypothetical protein -
L2Z13_RS04680 (L2Z13_04680) 955894..956208 - 315 WP_004728120.1 BrnA antitoxin family protein Antitoxin
L2Z13_RS04685 (L2Z13_04685) 956195..956482 - 288 WP_000438825.1 BrnT family toxin Toxin
L2Z13_RS04690 (L2Z13_04690) 956751..957281 - 531 WP_000172759.1 hypothetical protein -
L2Z13_RS04695 (L2Z13_04695) 957430..957732 + 303 WP_000286964.1 type II toxin-antitoxin system RelE/ParE family toxin -
L2Z13_RS04700 (L2Z13_04700) 957733..958014 + 282 WP_000985609.1 putative addiction module antidote protein -
L2Z13_RS04705 (L2Z13_04705) 958094..958513 - 420 WP_001180106.1 SMI1/KNR4 family protein -
L2Z13_RS04710 (L2Z13_04710) 958676..960010 + 1335 WP_033917544.1 ISNCY family transposase -
L2Z13_RS04715 (L2Z13_04715) 960139..960459 + 321 WP_000897307.1 type II toxin-antitoxin system RelE/ParE family toxin -
L2Z13_RS04720 (L2Z13_04720) 960452..960724 + 273 WP_000369781.1 NadS family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage sul2 - 947201..960010 12809
- inside IScluster/Tn sul2 / msr(E) / mph(E) / blaADC-25 - 950340..969147 18807


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Ribonuclease toxin, BrnT, of type II toxin-antitoxin system

(7-88)

Antitoxin

BrnA antitoxin of type II toxin-antitoxin system

(41-96)


Sequences

Toxin        


Download         Length: 96 a.a.        Molecular weight: 11304.70 Da        Isoelectric Point: 5.6205

>T233236 WP_000438825.1 NZ_CP091361:c956482-956195 [Acinetobacter baumannii]
MEQYFEWDEAKNRKNQKKHDISFETASLVFEDPLRISIQDRHTDGEERWQTIGRVKGVLMLLVAHTIFDEDDCEIIRIIS
ARQVTKAERNKYEHG

Download         Length: 288 bp

Antitoxin


Download         Length: 105 a.a.        Molecular weight: 12200.86 Da        Isoelectric Point: 8.4628

>AT233236 WP_004728120.1 NZ_CP091361:c956208-955894 [Acinetobacter baumannii]
MSMVRYSRKELNEKFGEKQDAEIQRLLAKGTVPDDQLDLSDIPEITDWSSAVRQNQFYRPVKQQTSIRLDADVLAWFKAQ
GKGYQTRMNEILRDAMLKELKNHQ

Download         Length: 315 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0A8TVQ4

Antitoxin

Source ID Structure
AlphaFold DB A0A0A8TRI9

References