Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/DinJ(antitoxin) |
Location | 1087892..1088525 | Replicon | chromosome |
Accession | NZ_CP089302 | ||
Organism | Bifidobacterium longum strain VHProbi Y08 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | W6EYF0 |
Locus tag | MTX55_RS04740 | Protein ID | WP_012577854.1 |
Coordinates | 1088157..1088525 (+) | Length | 123 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | - |
Locus tag | MTX55_RS04735 | Protein ID | WP_207436617.1 |
Coordinates | 1087892..1088176 (+) | Length | 95 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MTX55_RS04680 (LT344_04680) | 1083292..1083519 | + | 228 | WP_041473841.1 | helix-turn-helix transcriptional regulator | - |
MTX55_RS04685 (LT344_04685) | 1083670..1083936 | + | 267 | WP_015713493.1 | hypothetical protein | - |
MTX55_RS04690 (LT344_04690) | 1083950..1084219 | + | 270 | WP_015713494.1 | hypothetical protein | - |
MTX55_RS04695 (LT344_04695) | 1084721..1084933 | + | 213 | WP_069483789.1 | hypothetical protein | - |
MTX55_RS04700 (LT344_04700) | 1085003..1085164 | + | 162 | WP_155245937.1 | hypothetical protein | - |
MTX55_RS04705 (LT344_04705) | 1085161..1085505 | + | 345 | WP_207436620.1 | hypothetical protein | - |
MTX55_RS04710 (LT344_04710) | 1085621..1085962 | + | 342 | WP_207436619.1 | hypothetical protein | - |
MTX55_RS04715 (LT344_04715) | 1086160..1086906 | + | 747 | WP_207436618.1 | hypothetical protein | - |
MTX55_RS04720 (LT344_04720) | 1086909..1087250 | + | 342 | WP_200407903.1 | hypothetical protein | - |
MTX55_RS04725 (LT344_04725) | 1087250..1087432 | + | 183 | WP_052789116.1 | hypothetical protein | - |
MTX55_RS04730 (LT344_04730) | 1087518..1087820 | + | 303 | WP_206822301.1 | hypothetical protein | - |
MTX55_RS04735 (LT344_04735) | 1087892..1088176 | + | 285 | WP_207436617.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
MTX55_RS04740 (LT344_04740) | 1088157..1088525 | + | 369 | WP_012577854.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
MTX55_RS04745 (LT344_04745) | 1088712..1088975 | + | 264 | WP_015713504.1 | hypothetical protein | - |
MTX55_RS04750 (LT344_04750) | 1088972..1089199 | + | 228 | WP_207436616.1 | hypothetical protein | - |
MTX55_RS04755 (LT344_04755) | 1089196..1089342 | + | 147 | WP_207436799.1 | hypothetical protein | - |
MTX55_RS04760 (LT344_04760) | 1089451..1089699 | + | 249 | WP_015713507.1 | hypothetical protein | - |
MTX55_RS04765 (LT344_04765) | 1089895..1091112 | - | 1218 | WP_207436615.1 | RNA-guided endonuclease TnpB family protein | - |
MTX55_RS04770 (LT344_04770) | 1091261..1091527 | - | 267 | WP_041473844.1 | hypothetical protein | - |
MTX55_RS04775 (LT344_04775) | 1091524..1092039 | - | 516 | WP_207436614.1 | hypothetical protein | - |
MTX55_RS04780 (LT344_04780) | 1092588..1093388 | - | 801 | WP_207436613.1 | phage antirepressor KilAC domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 1052745..1114616 | 61871 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 123 a.a. Molecular weight: 13866.75 Da Isoelectric Point: 4.5746
>T227991 WP_012577854.1 NZ_CP089302:1088157-1088525 [Bifidobacterium longum]
MTSTPSEPRLYDVWLMWVEFPDHPGIGKPRPVVITEVDGDLVSGIVAKITGNTDWDEAGDVPLLDWKAEGLLKPSLVRCS
QRFYFNRSELLQWFGRLSLRDAEHVNDGLEATLDIPPYRRSV
MTSTPSEPRLYDVWLMWVEFPDHPGIGKPRPVVITEVDGDLVSGIVAKITGNTDWDEAGDVPLLDWKAEGLLKPSLVRCS
QRFYFNRSELLQWFGRLSLRDAEHVNDGLEATLDIPPYRRSV
Download Length: 369 bp
>T227991 NZ_CP123246:c51480-51331 [Escherichia coli]
ATGACGAAATATGCCCTTATCGGGTTGCTCGCCGTGTGCGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACGGTT
ATGTGAGCTGAATATTCACAGAGGAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAGTAA
ATGACGAAATATGCCCTTATCGGGTTGCTCGCCGTGTGCGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACGGTT
ATGTGAGCTGAATATTCACAGAGGAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAGTAA
Antitoxin
Download Length: 95 a.a. Molecular weight: 10531.82 Da Isoelectric Point: 4.5582
>AT227991 WP_207436617.1 NZ_CP089302:1087892-1088176 [Bifidobacterium longum]
MGKLVANIDDDIKARAAALYDSMGMSLSTAVNMFLRQSLVDNGLPFKPTRHTPDGYPVPPVHNAYMFERSEKGHVILPAD
WDDSEDDVYDQYAK
MGKLVANIDDDIKARAAALYDSMGMSLSTAVNMFLRQSLVDNGLPFKPTRHTPDGYPVPPVHNAYMFERSEKGHVILPAD
WDDSEDDVYDQYAK
Download Length: 285 bp
>AT227991 NZ_CP123246:51524-51585 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|