Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | paaR-paaA-parE/- |
Location | 2625156..2625627 | Replicon | chromosome |
Accession | NZ_CP089272 | ||
Organism | Escherichia coli O157:H7 strain M1300706001A |
Toxin (Protein)
Gene name | parE_1 | Uniprot ID | A0A0D7C2L1 |
Locus tag | LSI73_RS13410 | Protein ID | WP_001303511.1 |
Coordinates | 2625156..2625434 (-) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | paaA | Uniprot ID | Q8XAD5 |
Locus tag | LSI73_RS13415 | Protein ID | WP_001302048.1 |
Coordinates | 2625436..2625627 (-) | Length | 64 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LSI73_RS13385 (2622091) | 2622091..2623176 | - | 1086 | Protein_2619 | exonuclease | - |
LSI73_RS13390 (2623269) | 2623269..2623460 | - | 192 | WP_001090200.1 | DUF1482 family protein | - |
LSI73_RS13395 (2623457) | 2623457..2623645 | - | 189 | WP_000449192.1 | cell division inhibition protein DicB | - |
LSI73_RS13400 (2624214) | 2624214..2624432 | - | 219 | WP_001171930.1 | protein YdfC | - |
LSI73_RS13405 (2624504) | 2624504..2624803 | - | 300 | WP_001240334.1 | hypothetical protein | - |
LSI73_RS13410 (2625156) | 2625156..2625434 | - | 279 | WP_001303511.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
LSI73_RS13415 (2625436) | 2625436..2625627 | - | 192 | WP_001302048.1 | hypothetical protein | Antitoxin |
LSI73_RS13420 (2625648) | 2625648..2626019 | - | 372 | WP_001169686.1 | hypothetical protein | - |
LSI73_RS13425 (2626117) | 2626117..2626419 | + | 303 | WP_000172738.1 | transcriptional regulator | - |
LSI73_RS13430 (2626416) | 2626416..2626841 | + | 426 | WP_000693943.1 | toxin YdaT family protein | - |
LSI73_RS13435 (2626864) | 2626864..2627826 | + | 963 | WP_000095669.1 | helix-turn-helix domain-containing protein | - |
LSI73_RS13440 (2627833) | 2627833..2628573 | + | 741 | WP_000788938.1 | ATP-binding protein | - |
LSI73_RS13445 (2628599) | 2628599..2629368 | + | 770 | Protein_2631 | DUF1627 domain-containing protein | - |
LSI73_RS13450 (2629384) | 2629384..2629779 | + | 396 | WP_001118159.1 | DUF977 family protein | - |
LSI73_RS13455 (2629836) | 2629836..2630420 | + | 585 | WP_000206793.1 | DUF551 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | nleG7' | 2608963..2709817 | 100854 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10661.25 Da Isoelectric Point: 5.5647
>T227957 WP_001303511.1 NZ_CP089272:c2625434-2625156 [Escherichia coli O157:H7]
MLPVLWLESADTDLDDITSYIARFDIDAAERLWQRLRGCVLPLSEHPYLYPPSDRVPGLREIVAHPNYIILYRVTTSSVE
VVNVIHARRQFP
MLPVLWLESADTDLDDITSYIARFDIDAAERLWQRLRGCVLPLSEHPYLYPPSDRVPGLREIVAHPNYIILYRVTTSSVE
VVNVIHARRQFP
Download Length: 279 bp
>T227957 NZ_CP123240:2913991-2914098 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 64 a.a. Molecular weight: 7463.47 Da Isoelectric Point: 8.6828
>AT227957 WP_001302048.1 NZ_CP089272:c2625627-2625436 [Escherichia coli O157:H7]
MNRALSPMVSEFETIEQENSYNEWLRAKVATSLADPRPAIPHDEVERRMAERFAKMRKERSKQ
MNRALSPMVSEFETIEQENSYNEWLRAKVATSLADPRPAIPHDEVERRMAERFAKMRKERSKQ
Download Length: 192 bp
>AT227957 NZ_CP123240:c2913943-2913876 [Escherichia coli]
GTCTAGTTTCAAGATTAGCCCCCGTTTTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCTCT
GTCTAGTTTCAAGATTAGCCCCCGTTTTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|