Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | mazF-pemI/MazF(toxin) |
Location | 216593..217229 | Replicon | chromosome |
Accession | NZ_CP088245 | ||
Organism | Metabacillus sp. B2-18 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | A0A0M2PN83 |
Locus tag | LPC09_RS01195 | Protein ID | WP_026562078.1 |
Coordinates | 216879..217229 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | pemI | Uniprot ID | - |
Locus tag | LPC09_RS01190 | Protein ID | WP_098797598.1 |
Coordinates | 216593..216874 (+) | Length | 94 a.a. |
Genomic Context
Location: 213251..213616 (366 bp)
Type: Others
Protein ID: WP_098797595.1
Type: Others
Protein ID: WP_098797595.1
Location: 213833..214852 (1020 bp)
Type: Others
Protein ID: WP_269217413.1
Type: Others
Protein ID: WP_269217413.1
Location: 215119..216264 (1146 bp)
Type: Others
Protein ID: WP_231308823.1
Type: Others
Protein ID: WP_231308823.1
Location: 216593..216874 (282 bp)
Type: Antitoxin
Protein ID: WP_098797598.1
Type: Antitoxin
Protein ID: WP_098797598.1
Location: 216879..217229 (351 bp)
Type: Toxin
Protein ID: WP_026562078.1
Type: Toxin
Protein ID: WP_026562078.1
Location: 217565..218407 (843 bp)
Type: Others
Protein ID: WP_231308824.1
Type: Others
Protein ID: WP_231308824.1
Location: 218407..218769 (363 bp)
Type: Others
Protein ID: WP_098797600.1
Type: Others
Protein ID: WP_098797600.1
Location: 218773..219174 (402 bp)
Type: Others
Protein ID: WP_098797601.1
Type: Others
Protein ID: WP_098797601.1
Location: 219185..220192 (1008 bp)
Type: Others
Protein ID: WP_098797602.1
Type: Others
Protein ID: WP_098797602.1
Location: 220248..220580 (333 bp)
Type: Others
Protein ID: WP_098797603.1
Type: Others
Protein ID: WP_098797603.1
Location: 220577..221059 (483 bp)
Type: Others
Protein ID: WP_098797604.1
Type: Others
Protein ID: WP_098797604.1
Location: 221025..221816 (792 bp)
Type: Others
Protein ID: WP_098797605.1
Type: Others
Protein ID: WP_098797605.1
Location: 212398..213117 (720 bp)
Type: Others
Protein ID: WP_098797594.1
Type: Others
Protein ID: WP_098797594.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LPC09_RS01170 (LPC09_01170) | 212398..213117 | - | 720 | WP_098797594.1 | rhomboid family intramembrane serine protease | - |
LPC09_RS01175 (LPC09_01175) | 213251..213616 | + | 366 | WP_098797595.1 | holo-ACP synthase | - |
LPC09_RS01180 (LPC09_01180) | 213833..214852 | + | 1020 | WP_269217413.1 | outer membrane lipoprotein carrier protein LolA | - |
LPC09_RS01185 (LPC09_01185) | 215119..216264 | + | 1146 | WP_231308823.1 | alanine racemase | - |
LPC09_RS01190 (LPC09_01190) | 216593..216874 | + | 282 | WP_098797598.1 | antitoxin endoai | Antitoxin |
LPC09_RS01195 (LPC09_01195) | 216879..217229 | + | 351 | WP_026562078.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
LPC09_RS01200 (LPC09_01200) | 217565..218407 | + | 843 | WP_231308824.1 | STAS domain-containing protein | - |
LPC09_RS01205 (LPC09_01205) | 218407..218769 | + | 363 | WP_098797600.1 | STAS domain-containing protein | - |
LPC09_RS01210 (LPC09_01210) | 218773..219174 | + | 402 | WP_098797601.1 | anti-sigma regulatory factor | - |
LPC09_RS01215 (LPC09_01215) | 219185..220192 | + | 1008 | WP_098797602.1 | PP2C family protein-serine/threonine phosphatase | - |
LPC09_RS01220 (LPC09_01220) | 220248..220580 | + | 333 | WP_098797603.1 | anti-sigma factor antagonist | - |
LPC09_RS01225 (LPC09_01225) | 220577..221059 | + | 483 | WP_098797604.1 | anti-sigma B factor RsbW | - |
LPC09_RS01230 (LPC09_01230) | 221025..221816 | + | 792 | WP_098797605.1 | RNA polymerase sigma factor SigB | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
No matching records found |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 13020.06 Da Isoelectric Point: 4.8781
>T227005 WP_026562078.1 NZ_CP088245:216879-217229 [Metabacillus sp. B2-18]
MIVKRGDVYFADLSPVVGSEQGGVRPVLIIQNDIGNRFSPTVIIAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLGLIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLIIQNDIGNRFSPTVIIAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLGLIDF
Download Length: 351 bp
>T227005 NZ_CP122678:c94810-94658 [Escherichia coli]
ATGCCACAGCGAACGTTTTTAATGATGTTAATCGTCATCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGGACTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA
ATGCCACAGCGAACGTTTTTAATGATGTTAATCGTCATCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGGACTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA
Antitoxin
Download Length: 94 a.a. Molecular weight: 10598.08 Da Isoelectric Point: 5.8851
>AT227005 WP_098797598.1 NZ_CP088245:216593-216874 [Metabacillus sp. B2-18]
VSESSATTEILIQLPQALVSELDVLVKQENGNRNELIYQATKMYIRERKKRQIRESMRRGYMEMAKINLNIASEAFLAES
EADHTVERLVSGG
VSESSATTEILIQLPQALVSELDVLVKQENGNRNELIYQATKMYIRERKKRQIRESMRRGYMEMAKINLNIASEAFLAES
EADHTVERLVSGG
Download Length: 282 bp
>AT227005 NZ_CP122678:94865-94922 [Escherichia coli]
GCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
GCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0M2PN83 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
No matching records found |