Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 50177..50702 Replicon plasmid pB-4549_1
Accession NZ_CP088139
Organism Salmonella enterica subsp. enterica serovar Hissar strain SCPM-O-B-4549

Toxin (Protein)


Gene name ccdB Uniprot ID I3W3D5
Locus tag LRM92_RS24180 Protein ID WP_001159863.1
Coordinates 50397..50702 (+) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID -
Locus tag LRM92_RS24175 Protein ID WP_156038185.1
Coordinates 50177..50395 (+) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LRM92_RS24135 (LRM92_24130) 45249..45671 - 423 WP_001340589.1 organomercurial transporter MerC -
LRM92_RS24140 (LRM92_24135) 45707..45982 - 276 WP_000732292.1 mercury resistance system periplasmic binding protein MerP -
LRM92_RS24145 (LRM92_24140) 45996..46346 - 351 WP_001294663.1 mercuric transport protein MerT -
LRM92_RS24150 (LRM92_24145) 46418..46852 + 435 WP_000429836.1 Hg(II)-responsive transcriptional regulator -
LRM92_RS24155 (LRM92_24150) 46885..47706 - 822 Protein_51 RepB family plasmid replication initiator protein -
LRM92_RS24160 (LRM92_24155) 48200..48496 - 297 WP_001687482.1 hypothetical protein -
LRM92_RS24165 (LRM92_24160) 48508..48936 + 429 Protein_53 hypothetical protein -
LRM92_RS24170 (LRM92_24165) 48980..49501 - 522 WP_010999942.1 hypothetical protein -
LRM92_RS24175 (LRM92_24170) 50177..50395 + 219 WP_156038185.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
LRM92_RS24180 (LRM92_24175) 50397..50702 + 306 WP_001159863.1 type II toxin-antitoxin system toxin CcdB Toxin
LRM92_RS24185 (LRM92_24180) 50704..50994 + 291 WP_001266176.1 hypothetical protein -
LRM92_RS24190 (LRM92_24185) 50991..51512 + 522 WP_000198608.1 hypothetical protein -
LRM92_RS24195 (LRM92_24190) 51547..52329 + 783 WP_000082169.1 site-specific integrase -
LRM92_RS24200 (LRM92_24195) 52338..52889 + 552 WP_000545754.1 EAL domain-containing protein -
LRM92_RS24205 (LRM92_24200) 53076..53564 + 489 WP_001075507.1 CaiF/GrlA family transcriptional regulator -
LRM92_RS24210 (LRM92_24205) 53558..54043 + 486 WP_000905606.1 membrane protein -
LRM92_RS24215 (LRM92_24210) 54320..54607 - 288 WP_071530243.1 hypothetical protein -
LRM92_RS24220 (LRM92_24215) 54763..55323 + 561 WP_000900095.1 inverse autotransporter beta domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid ant(2'')-Ia / sul1 / dfrA23 / blaOXA-1 / ant(3'')-Ia rck / pefD / pefC / pefA / pefB / fdeC / spvC / spvB 1..125931 125931


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11587.48 Da        Isoelectric Point: 6.9787

>T226812 WP_001159863.1 NZ_CP088139:50397-50702 [Salmonella enterica subsp. enterica serovar Hissar]
MQFKVYTCKRESRYRLFVDVQSDIIDTPGRRMAVPLVSARLLSEKVPRDLYPVMHIGDEPYRLLTTDMTSVPATVIGEEV
ADLSLRENDIKNAINLMFRGI

Download         Length: 306 bp

>T226812 NZ_CP122631:7610-7762 [Escherichia coli]
ATGCCACAGCGAACGTTTTTAATGATGTTAATCGTCATCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGGACTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8286.10 Da        Isoelectric Point: 4.5203

>AT226812 WP_156038185.1 NZ_CP088139:50177-50395 [Salmonella enterica subsp. enterica serovar Hissar]
MKQRITVTVDSDSYQLLKAYDVNISGLASTTMQNEARRLRAERWQEENREGMAEVASFIEANGSFADDNRNW

Download         Length: 219 bp

>AT226812 NZ_CP122631:c7555-7498 [Escherichia coli]
GCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB I3W3D5

Antitoxin

Source ID Structure

References