Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 2378938..2379464 | Replicon | chromosome |
| Accession | NZ_CP088131 | ||
| Organism | Escherichia coli strain 81 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | S1EXL1 |
| Locus tag | LRM32_RS11660 | Protein ID | WP_000323025.1 |
| Coordinates | 2379177..2379464 (+) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | S1F6D3 |
| Locus tag | LRM32_RS11655 | Protein ID | WP_000534858.1 |
| Coordinates | 2378938..2379177 (+) | Length | 80 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LRM32_RS11615 (2373978) | 2373978..2374399 | + | 422 | Protein_2279 | hypothetical protein | - |
| LRM32_RS11620 (2375034) | 2375034..2375405 | + | 372 | WP_001406656.1 | helix-turn-helix domain-containing protein | - |
| LRM32_RS11625 (2375443) | 2375443..2376105 | + | 663 | Protein_2281 | ISNCY family transposase | - |
| LRM32_RS11630 (2376226) | 2376226..2376375 | + | 150 | WP_011443592.1 | protein YdfW | - |
| LRM32_RS11635 (2376812) | 2376812..2377024 | - | 213 | Protein_2283 | FlxA-like family protein | - |
| LRM32_RS11640 (2377088) | 2377088..2378250 | + | 1163 | WP_085947771.1 | IS3-like element IS3 family transposase | - |
| LRM32_RS11645 (2378280) | 2378280..2378405 | - | 126 | Protein_2285 | protein FlxA | - |
| LRM32_RS11650 (2378608) | 2378608..2378913 | - | 306 | WP_001326990.1 | protein YdfV | - |
| LRM32_RS11655 (2378938) | 2378938..2379177 | + | 240 | WP_000534858.1 | type II toxin-antitoxin system antitoxin RelB | Antitoxin |
| LRM32_RS11660 (2379177) | 2379177..2379464 | + | 288 | WP_000323025.1 | type II toxin-antitoxin system mRNA interferase RelE | Toxin |
| LRM32_RS11665 (2379536) | 2379536..2379691 | + | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | - |
| LRM32_RS11670 (2379908) | 2379908..2380159 | + | 252 | WP_000980994.1 | protein Rem | - |
| LRM32_RS11675 (2380226) | 2380226..2380504 | + | 279 | WP_012304870.1 | hypothetical protein | - |
| LRM32_RS11680 (2380506) | 2380506..2381555 | + | 1050 | WP_001265198.1 | DUF968 domain-containing protein | - |
| LRM32_RS11685 (2381569) | 2381569..2382321 | + | 753 | WP_001047135.1 | antitermination protein | - |
| LRM32_RS11690 (2382470) | 2382470..2383167 | + | 698 | WP_103215986.1 | IS1-like element IS1A family transposase | - |
| LRM32_RS11695 (2383376) | 2383376..2383465 | - | 90 | WP_120795389.1 | hypothetical protein | - |
| LRM32_RS11700 (2383520) | 2383520..2383732 | - | 213 | WP_000087756.1 | cold shock-like protein CspF | - |
| LRM32_RS11705 (2384033) | 2384033..2384248 | + | 216 | WP_000066484.1 | cold shock-like protein CspB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 2352474..2394661 | 42187 | |
| - | inside | IScluster/Tn | - | - | 2377088..2383167 | 6079 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11225.22 Da Isoelectric Point: 10.1967
>T226730 WP_000323025.1 NZ_CP088131:2379177-2379464 [Escherichia coli]
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
Download Length: 288 bp
>T226730 NZ_CP122617:2638117-2638224 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 80 a.a. Molecular weight: 9071.48 Da Isoelectric Point: 4.5230
>AT226730 WP_000534858.1 NZ_CP088131:2378938-2379177 [Escherichia coli]
MGSINLRIDDELKARSYAALEKMGVTPSEALRLMLEYIADNERLPFKQTLLSDEDAELVEIVKERLRNPKPVRVTLDEL
MGSINLRIDDELKARSYAALEKMGVTPSEALRLMLEYIADNERLPFKQTLLSDEDAELVEIVKERLRNPKPVRVTLDEL
Download Length: 240 bp
>AT226730 NZ_CP122617:c2638067-2638004 [Escherichia coli]
TCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT
TCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|