Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | hicAB/HicB(antitoxin) |
Location | 1423372..1424029 | Replicon | chromosome |
Accession | NZ_CP087800 | ||
Organism | Moraxella bovis strain SAM57953 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | - |
Locus tag | LP087_RS06955 | Protein ID | WP_264676287.1 |
Coordinates | 1423372..1423554 (+) | Length | 61 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | LP087_RS06960 | Protein ID | WP_264676286.1 |
Coordinates | 1423616..1424029 (+) | Length | 138 a.a. |
Genomic Context
Location: 1421395..1421604 (210 bp)
Type: Others
Protein ID: WP_264676290.1
Type: Others
Protein ID: WP_264676290.1
Location: 1421641..1421841 (201 bp)
Type: Others
Protein ID: WP_264676289.1
Type: Others
Protein ID: WP_264676289.1
Location: 1423372..1423554 (183 bp)
Type: Toxin
Protein ID: WP_264676287.1
Type: Toxin
Protein ID: WP_264676287.1
Location: 1423616..1424029 (414 bp)
Type: Antitoxin
Protein ID: WP_264676286.1
Type: Antitoxin
Protein ID: WP_264676286.1
Location: 1419345..1420742 (1398 bp)
Type: Others
Protein ID: WP_264676292.1
Type: Others
Protein ID: WP_264676292.1
Location: 1420742..1421281 (540 bp)
Type: Others
Protein ID: WP_264676291.1
Type: Others
Protein ID: WP_264676291.1
Location: 1422268..1422972 (705 bp)
Type: Others
Protein ID: WP_264676288.1
Type: Others
Protein ID: WP_264676288.1
Location: 1424040..1424441 (402 bp)
Type: Others
Protein ID: WP_264676285.1
Type: Others
Protein ID: WP_264676285.1
Location: 1424425..1424646 (222 bp)
Type: Others
Protein ID: WP_264676284.1
Type: Others
Protein ID: WP_264676284.1
Location: 1424643..1424798 (156 bp)
Type: Others
Protein ID: WP_264676283.1
Type: Others
Protein ID: WP_264676283.1
Location: 1424935..1425420 (486 bp)
Type: Others
Protein ID: WP_078273444.1
Type: Others
Protein ID: WP_078273444.1
Location: 1425417..1425707 (291 bp)
Type: Others
Protein ID: WP_112742084.1
Type: Others
Protein ID: WP_112742084.1
Location: 1425729..1426007 (279 bp)
Type: Others
Protein ID: WP_078273442.1
Type: Others
Protein ID: WP_078273442.1
Location: 1426004..1426399 (396 bp)
Type: Others
Protein ID: WP_264717794.1
Type: Others
Protein ID: WP_264717794.1
Location: 1426396..1427004 (609 bp)
Type: Others
Protein ID: WP_264676191.1
Type: Others
Protein ID: WP_264676191.1
Location: 1426997..1427887 (891 bp)
Type: Others
Protein ID: WP_264676778.1
Type: Others
Protein ID: WP_264676778.1
Location: 1427884..1428567 (684 bp)
Type: Others
Protein ID: WP_264676189.1
Type: Others
Protein ID: WP_264676189.1
Location: 1428635..1428910 (276 bp)
Type: Others
Protein ID: WP_112742261.1
Type: Others
Protein ID: WP_112742261.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LP087_RS06930 (LP087_06860) | 1419345..1420742 | - | 1398 | WP_264676292.1 | phage terminase large subunit | - |
LP087_RS06935 (LP087_06865) | 1420742..1421281 | - | 540 | WP_264676291.1 | terminase small subunit | - |
LP087_RS06940 (LP087_06870) | 1421395..1421604 | + | 210 | WP_264676290.1 | hypothetical protein | - |
LP087_RS06945 (LP087_06875) | 1421641..1421841 | + | 201 | WP_264676289.1 | helix-turn-helix domain-containing protein | - |
LP087_RS06950 (LP087_06880) | 1422268..1422972 | - | 705 | WP_264676288.1 | BRO family protein | - |
LP087_RS06955 (LP087_06885) | 1423372..1423554 | + | 183 | WP_264676287.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
LP087_RS06960 (LP087_06890) | 1423616..1424029 | + | 414 | WP_264676286.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
LP087_RS06965 (LP087_06895) | 1424040..1424441 | - | 402 | WP_264676285.1 | antiterminator Q family protein | - |
LP087_RS06970 (LP087_06900) | 1424425..1424646 | - | 222 | WP_264676284.1 | DUF3310 domain-containing protein | - |
LP087_RS06975 (LP087_06905) | 1424643..1424798 | - | 156 | WP_264676283.1 | hypothetical protein | - |
LP087_RS06980 (LP087_06910) | 1424935..1425420 | - | 486 | WP_078273444.1 | recombination protein NinB | - |
LP087_RS06985 (LP087_06915) | 1425417..1425707 | - | 291 | WP_112742084.1 | hypothetical protein | - |
LP087_RS06990 (LP087_06920) | 1425729..1426007 | - | 279 | WP_078273442.1 | DUF968 domain-containing protein | - |
LP087_RS06995 (LP087_06925) | 1426004..1426399 | - | 396 | WP_264717794.1 | VRR-NUC domain-containing protein | - |
LP087_RS07000 (LP087_06930) | 1426396..1427004 | - | 609 | WP_264676191.1 | hypothetical protein | - |
LP087_RS07005 (LP087_06935) | 1426997..1427887 | - | 891 | WP_264676778.1 | replication protein | - |
LP087_RS07010 (LP087_06940) | 1427884..1428567 | - | 684 | WP_264676189.1 | Rha family transcriptional regulator | - |
LP087_RS07015 (LP087_06945) | 1428635..1428910 | - | 276 | WP_112742261.1 | YdaS family helix-turn-helix protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 1403311..1449215 | 45904 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6761.81 Da Isoelectric Point: 10.7622
>T226193 WP_264676287.1 NZ_CP087800:1423372-1423554 [Moraxella bovis]
MKYSEFQRWLLAQGATVNKQGGKGSHRKVTLNGKTTTFPYHGSKEIGEGLRKKILKDLDL
MKYSEFQRWLLAQGATVNKQGGKGSHRKVTLNGKTTTFPYHGSKEIGEGLRKKILKDLDL
Download Length: 183 bp
>T226193 NZ_CP122317:c4408304-4408197 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 138 a.a. Molecular weight: 15339.53 Da Isoelectric Point: 4.7523
>AT226193 WP_264676286.1 NZ_CP087800:1423616-1424029 [Moraxella bovis]
MYYPATFTPDTNDTFLVAFRDIPEAVGVGETFEIAYQSALDGLETAFSIYMDERKPIPAPSELSDGEHAIYLPVAVQTKL
ALYHEMLAQGVTKAELARRLSVNQKQIDRLWDVSHSTKLEFLEKAFSVLGKRLSLAI
MYYPATFTPDTNDTFLVAFRDIPEAVGVGETFEIAYQSALDGLETAFSIYMDERKPIPAPSELSDGEHAIYLPVAVQTKL
ALYHEMLAQGVTKAELARRLSVNQKQIDRLWDVSHSTKLEFLEKAFSVLGKRLSLAI
Download Length: 414 bp
>AT226193 NZ_CP122317:4408351-4408417 [Escherichia coli]
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT