Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relE-yefM/YoeB-RelB |
| Location | 1163506..1163995 | Replicon | chromosome |
| Accession | NZ_CP087793 | ||
| Organism | Moraxella bovis strain SAM57959 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | LP112_RS06260 | Protein ID | WP_112742208.1 |
| Coordinates | 1163738..1163995 (+) | Length | 86 a.a. |
Antitoxin (Protein)
| Gene name | yefM | Uniprot ID | - |
| Locus tag | LP112_RS06255 | Protein ID | WP_228157840.1 |
| Coordinates | 1163506..1163748 (+) | Length | 81 a.a. |
Genomic Context
Location: 1158606..1159655 (1050 bp)
Type: Others
Protein ID: WP_264676261.1
Type: Others
Protein ID: WP_264676261.1
Location: 1159774..1160571 (798 bp)
Type: Others
Protein ID: WP_264676262.1
Type: Others
Protein ID: WP_264676262.1
Location: 1160568..1160780 (213 bp)
Type: Others
Protein ID: WP_264676263.1
Type: Others
Protein ID: WP_264676263.1
Location: 1160770..1161288 (519 bp)
Type: Others
Protein ID: WP_264676264.1
Type: Others
Protein ID: WP_264676264.1
Location: 1161451..1162684 (1234 bp)
Type: Others
Protein ID: Protein_1219
Type: Others
Protein ID: Protein_1219
Location: 1162928..1163215 (288 bp)
Type: Others
Protein ID: WP_078273310.1
Type: Others
Protein ID: WP_078273310.1
Location: 1163506..1163748 (243 bp)
Type: Antitoxin
Protein ID: WP_228157840.1
Type: Antitoxin
Protein ID: WP_228157840.1
Location: 1163738..1163995 (258 bp)
Type: Toxin
Protein ID: WP_112742208.1
Type: Toxin
Protein ID: WP_112742208.1
Location: 1164054..1164563 (510 bp)
Type: Others
Protein ID: WP_112742209.1
Type: Others
Protein ID: WP_112742209.1
Location: 1164629..1165432 (804 bp)
Type: Others
Protein ID: WP_078273307.1
Type: Others
Protein ID: WP_078273307.1
Location: 1163297..1163461 (165 bp)
Type: Others
Protein ID: WP_162860378.1
Type: Others
Protein ID: WP_162860378.1
Location: 1165528..1168050 (2523 bp)
Type: Others
Protein ID: WP_112742210.1
Type: Others
Protein ID: WP_112742210.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LP112_RS06220 (LP112_06185) | 1158606..1159655 | + | 1050 | WP_264676261.1 | RluA family pseudouridine synthase | - |
| LP112_RS06225 (LP112_06190) | 1159774..1160571 | + | 798 | WP_264676262.1 | polyphenol oxidase family protein | - |
| LP112_RS06230 | 1160568..1160780 | + | 213 | WP_264676263.1 | bestrophin family protein | - |
| LP112_RS06235 (LP112_06195) | 1160770..1161288 | + | 519 | WP_264676264.1 | bestrophin family protein | - |
| LP112_RS06240 (LP112_06200) | 1161451..1162684 | + | 1234 | Protein_1219 | DUF853 family protein | - |
| LP112_RS06245 (LP112_06205) | 1162928..1163215 | + | 288 | WP_078273310.1 | DUF1315 family protein | - |
| LP112_RS06250 (LP112_06210) | 1163297..1163461 | - | 165 | WP_162860378.1 | hypothetical protein | - |
| LP112_RS06255 (LP112_06215) | 1163506..1163748 | + | 243 | WP_228157840.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
| LP112_RS06260 (LP112_06220) | 1163738..1163995 | + | 258 | WP_112742208.1 | Txe/YoeB family addiction module toxin | Toxin |
| LP112_RS06265 (LP112_06225) | 1164054..1164563 | + | 510 | WP_112742209.1 | peptidylprolyl isomerase | - |
| LP112_RS06270 (LP112_06230) | 1164629..1165432 | + | 804 | WP_078273307.1 | UDP-2,3-diacylglucosamine diphosphatase | - |
| LP112_RS06275 (LP112_06235) | 1165528..1168050 | - | 2523 | WP_112742210.1 | alpha/beta hydrolase | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| No matching records found | |||||||
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 86 a.a. Molecular weight: 10488.99 Da Isoelectric Point: 7.6652
>T226164 WP_112742208.1 NZ_CP087793:1163738-1163995 [Moraxella bovis]
MRIRWFDEVWEDYLYWQSQDKKTIKRINTLIKDCRRDPFDGIGKPEPLKYNLTGYWLRRIDDANRLVYCCESETLIISCR
HHYEA
MRIRWFDEVWEDYLYWQSQDKKTIKRINTLIKDCRRDPFDGIGKPEPLKYNLTGYWLRRIDDANRLVYCCESETLIISCR
HHYEA
Download Length: 258 bp
>T226164 NZ_CP122316:3813322-3813429 [Escherichia coli]
ATGACGTTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
ATGACGTTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
Antitoxin
Download Length: 81 a.a. Molecular weight: 9134.23 Da Isoelectric Point: 6.2120
>AT226164 WP_228157840.1 NZ_CP087793:1163506-1163748 [Moraxella bovis]
MNYSEFRQNLASALDYVQDSHAPVIVKRGKHSAVVISLDEYNAFKETDYLLSNPANAEHLMRGVQAVKNRQLTQRDLIED
MNYSEFRQNLASALDYVQDSHAPVIVKRGKHSAVVISLDEYNAFKETDYLLSNPANAEHLMRGVQAVKNRQLTQRDLIED
Download Length: 243 bp
>AT226164 NZ_CP122316:c3813273-3813207 [Escherichia coli]
GTCTAGAGTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
GTCTAGAGTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC