Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | relE-yefM/YoeB-RelB |
Location | 1587002..1587491 | Replicon | chromosome |
Accession | NZ_CP087771 | ||
Organism | Moraxella bovis strain SAM109244 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | LP127_RS07695 | Protein ID | WP_112742208.1 |
Coordinates | 1587002..1587259 (-) | Length | 86 a.a. |
Antitoxin (Protein)
Gene name | yefM | Uniprot ID | - |
Locus tag | LP127_RS07700 | Protein ID | WP_228157840.1 |
Coordinates | 1587249..1587491 (-) | Length | 81 a.a. |
Genomic Context
Location: 1582947..1585469 (2523 bp)
Type: Others
Protein ID: WP_112742210.1
Type: Others
Protein ID: WP_112742210.1
Location: 1587536..1587700 (165 bp)
Type: Others
Protein ID: WP_162860378.1
Type: Others
Protein ID: WP_162860378.1
Location: 1585565..1586368 (804 bp)
Type: Others
Protein ID: WP_078273307.1
Type: Others
Protein ID: WP_078273307.1
Location: 1586434..1586943 (510 bp)
Type: Others
Protein ID: WP_112742209.1
Type: Others
Protein ID: WP_112742209.1
Location: 1587002..1587259 (258 bp)
Type: Toxin
Protein ID: WP_112742208.1
Type: Toxin
Protein ID: WP_112742208.1
Location: 1587249..1587491 (243 bp)
Type: Antitoxin
Protein ID: WP_228157840.1
Type: Antitoxin
Protein ID: WP_228157840.1
Location: 1587782..1588069 (288 bp)
Type: Others
Protein ID: WP_078273310.1
Type: Others
Protein ID: WP_078273310.1
Location: 1588313..1589546 (1234 bp)
Type: Others
Protein ID: Protein_1502
Type: Others
Protein ID: Protein_1502
Location: 1589709..1590227 (519 bp)
Type: Others
Protein ID: WP_264676264.1
Type: Others
Protein ID: WP_264676264.1
Location: 1590217..1590429 (213 bp)
Type: Others
Protein ID: WP_264676263.1
Type: Others
Protein ID: WP_264676263.1
Location: 1590426..1591223 (798 bp)
Type: Others
Protein ID: WP_264676262.1
Type: Others
Protein ID: WP_264676262.1
Location: 1591342..1592391 (1050 bp)
Type: Others
Protein ID: WP_264676261.1
Type: Others
Protein ID: WP_264676261.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LP127_RS07680 (LP127_07615) | 1582947..1585469 | + | 2523 | WP_112742210.1 | alpha/beta hydrolase | - |
LP127_RS07685 (LP127_07620) | 1585565..1586368 | - | 804 | WP_078273307.1 | UDP-2,3-diacylglucosamine diphosphatase | - |
LP127_RS07690 (LP127_07625) | 1586434..1586943 | - | 510 | WP_112742209.1 | peptidylprolyl isomerase | - |
LP127_RS07695 (LP127_07630) | 1587002..1587259 | - | 258 | WP_112742208.1 | Txe/YoeB family addiction module toxin | Toxin |
LP127_RS07700 (LP127_07635) | 1587249..1587491 | - | 243 | WP_228157840.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
LP127_RS07705 (LP127_07640) | 1587536..1587700 | + | 165 | WP_162860378.1 | hypothetical protein | - |
LP127_RS07710 (LP127_07645) | 1587782..1588069 | - | 288 | WP_078273310.1 | DUF1315 family protein | - |
LP127_RS07715 (LP127_07650) | 1588313..1589546 | - | 1234 | Protein_1502 | DUF853 family protein | - |
LP127_RS07720 (LP127_07655) | 1589709..1590227 | - | 519 | WP_264676264.1 | bestrophin family protein | - |
LP127_RS07725 (LP127_07660) | 1590217..1590429 | - | 213 | WP_264676263.1 | bestrophin family protein | - |
LP127_RS07730 (LP127_07665) | 1590426..1591223 | - | 798 | WP_264676262.1 | polyphenol oxidase family protein | - |
LP127_RS07735 (LP127_07670) | 1591342..1592391 | - | 1050 | WP_264676261.1 | RluA family pseudouridine synthase | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
No matching records found |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 86 a.a. Molecular weight: 10488.99 Da Isoelectric Point: 7.6652
>T226121 WP_112742208.1 NZ_CP087771:c1587259-1587002 [Moraxella bovis]
MRIRWFDEVWEDYLYWQSQDKKTIKRINTLIKDCRRDPFDGIGKPEPLKYNLTGYWLRRIDDANRLVYCCESETLIISCR
HHYEA
MRIRWFDEVWEDYLYWQSQDKKTIKRINTLIKDCRRDPFDGIGKPEPLKYNLTGYWLRRIDDANRLVYCCESETLIISCR
HHYEA
Download Length: 258 bp
>T226121 NZ_CP122315:c479734-479627 [Escherichia coli]
ATGACGTTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
ATGACGTTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
Antitoxin
Download Length: 81 a.a. Molecular weight: 9134.23 Da Isoelectric Point: 6.2120
>AT226121 WP_228157840.1 NZ_CP087771:c1587491-1587249 [Moraxella bovis]
MNYSEFRQNLASALDYVQDSHAPVIVKRGKHSAVVISLDEYNAFKETDYLLSNPANAEHLMRGVQAVKNRQLTQRDLIED
MNYSEFRQNLASALDYVQDSHAPVIVKRGKHSAVVISLDEYNAFKETDYLLSNPANAEHLMRGVQAVKNRQLTQRDLIED
Download Length: 243 bp
>AT226121 NZ_CP122315:479783-479849 [Escherichia coli]
GTCTAGAGTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
GTCTAGAGTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC