Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | hicAB/HicA-HicB |
Location | 3089214..3089835 | Replicon | chromosome |
Accession | NZ_CP087197 | ||
Organism | Pseudomonas sp. B21-012 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | A0A2G8MXB6 |
Locus tag | LOY37_RS14105 | Protein ID | WP_016715573.1 |
Coordinates | 3089214..3089396 (+) | Length | 61 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | LOY37_RS14110 | Protein ID | WP_045194468.1 |
Coordinates | 3089434..3089835 (+) | Length | 134 a.a. |
Genomic Context
Location: 3086978..3087382 (405 bp)
Type: Others
Protein ID: WP_258715006.1
Type: Others
Protein ID: WP_258715006.1
Location: 3089214..3089396 (183 bp)
Type: Toxin
Protein ID: WP_016715573.1
Type: Toxin
Protein ID: WP_016715573.1
Location: 3089434..3089835 (402 bp)
Type: Antitoxin
Protein ID: WP_045194468.1
Type: Antitoxin
Protein ID: WP_045194468.1
Location: 3084811..3086301 (1491 bp)
Type: Others
Protein ID: WP_258715005.1
Type: Others
Protein ID: WP_258715005.1
Location: 3086305..3086904 (600 bp)
Type: Others
Protein ID: WP_045194460.1
Type: Others
Protein ID: WP_045194460.1
Location: 3087433..3087855 (423 bp)
Type: Others
Protein ID: WP_258715007.1
Type: Others
Protein ID: WP_258715007.1
Location: 3087852..3088067 (216 bp)
Type: Others
Protein ID: WP_258715008.1
Type: Others
Protein ID: WP_258715008.1
Location: 3088121..3088453 (333 bp)
Type: Others
Protein ID: WP_045194464.1
Type: Others
Protein ID: WP_045194464.1
Location: 3088522..3089088 (567 bp)
Type: Others
Protein ID: WP_258715009.1
Type: Others
Protein ID: WP_258715009.1
Location: 3089996..3090667 (672 bp)
Type: Others
Protein ID: WP_258715010.1
Type: Others
Protein ID: WP_258715010.1
Location: 3090664..3090810 (147 bp)
Type: Others
Protein ID: WP_258715011.1
Type: Others
Protein ID: WP_258715011.1
Location: 3090807..3091403 (597 bp)
Type: Others
Protein ID: WP_258715012.1
Type: Others
Protein ID: WP_258715012.1
Location: 3091400..3091561 (162 bp)
Type: Others
Protein ID: WP_258715013.1
Type: Others
Protein ID: WP_258715013.1
Location: 3091558..3092004 (447 bp)
Type: Others
Protein ID: WP_258715014.1
Type: Others
Protein ID: WP_258715014.1
Location: 3091997..3092257 (261 bp)
Type: Others
Protein ID: WP_258715015.1
Type: Others
Protein ID: WP_258715015.1
Location: 3092250..3092471 (222 bp)
Type: Others
Protein ID: WP_258715016.1
Type: Others
Protein ID: WP_258715016.1
Location: 3092471..3093265 (795 bp)
Type: Others
Protein ID: WP_258715017.1
Type: Others
Protein ID: WP_258715017.1
Location: 3093255..3094052 (798 bp)
Type: Others
Protein ID: WP_258717193.1
Type: Others
Protein ID: WP_258717193.1
Location: 3094052..3094810 (759 bp)
Type: Others
Protein ID: WP_258715018.1
Type: Others
Protein ID: WP_258715018.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LOY37_RS14070 (LOY37_14060) | 3084811..3086301 | - | 1491 | WP_258715005.1 | terminase | - |
LOY37_RS14075 (LOY37_14065) | 3086305..3086904 | - | 600 | WP_045194460.1 | hypothetical protein | - |
LOY37_RS14080 (LOY37_14070) | 3086978..3087382 | + | 405 | WP_258715006.1 | hypothetical protein | - |
LOY37_RS14085 (LOY37_14075) | 3087433..3087855 | - | 423 | WP_258715007.1 | proteasome subunit beta | - |
LOY37_RS14090 (LOY37_14080) | 3087852..3088067 | - | 216 | WP_258715008.1 | hypothetical protein | - |
LOY37_RS14095 (LOY37_14085) | 3088121..3088453 | - | 333 | WP_045194464.1 | phage holin, lambda family | - |
LOY37_RS14100 (LOY37_14090) | 3088522..3089088 | - | 567 | WP_258715009.1 | hypothetical protein | - |
LOY37_RS14105 (LOY37_14095) | 3089214..3089396 | + | 183 | WP_016715573.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
LOY37_RS14110 (LOY37_14100) | 3089434..3089835 | + | 402 | WP_045194468.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
LOY37_RS14115 (LOY37_14105) | 3089996..3090667 | - | 672 | WP_258715010.1 | hypothetical protein | - |
LOY37_RS14120 (LOY37_14110) | 3090664..3090810 | - | 147 | WP_258715011.1 | hypothetical protein | - |
LOY37_RS14125 (LOY37_14115) | 3090807..3091403 | - | 597 | WP_258715012.1 | recombination protein NinG | - |
LOY37_RS14130 (LOY37_14120) | 3091400..3091561 | - | 162 | WP_258715013.1 | hypothetical protein | - |
LOY37_RS14135 (LOY37_14125) | 3091558..3092004 | - | 447 | WP_258715014.1 | recombination protein NinB | - |
LOY37_RS14140 (LOY37_14130) | 3091997..3092257 | - | 261 | WP_258715015.1 | hypothetical protein | - |
LOY37_RS14145 (LOY37_14135) | 3092250..3092471 | - | 222 | WP_258715016.1 | hypothetical protein | - |
LOY37_RS14150 (LOY37_14140) | 3092471..3093265 | - | 795 | WP_258715017.1 | ATP-binding protein | - |
LOY37_RS14155 (LOY37_14145) | 3093255..3094052 | - | 798 | WP_258717193.1 | hypothetical protein | - |
LOY37_RS14160 (LOY37_14150) | 3094052..3094810 | - | 759 | WP_258715018.1 | phage antirepressor KilAC domain-containing protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 3056251..3115778 | 59527 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6696.86 Da Isoelectric Point: 11.2336
>T225105 WP_016715573.1 NZ_CP087197:3089214-3089396 [Pseudomonas sp. B21-012]
VQSRQLIKELEAAGWVLKRVTGSHHIFKHPNNPNSIPVPHPKKDLPIGTVKSIKERAGLK
VQSRQLIKELEAAGWVLKRVTGSHHIFKHPNNPNSIPVPHPKKDLPIGTVKSIKERAGLK
Download Length: 183 bp
>T225105 NZ_CP120970:2670902-2671153 [Moellerella wisconsensis]
ATGAAAGCGGTAAGCTACAGTGAAGCCAGACAGAATTTATCAACAACAATGATTCAAACAGTTGAAGATAGAGTACCAGT
ACTGATCACGCGCCAGAATGGCGAATCATGTGTACTGATGTCTCTCGATGAATATAACTCTCTCGAAGAGACGGCATACC
TAATGAGATCACCAAAAAATGCACGCAGACTTATGGACTCGATAGAAAGCCTAAAAGATGGAAAAGGGATGGAAAGGGAA
ATTATTAAGTGA
ATGAAAGCGGTAAGCTACAGTGAAGCCAGACAGAATTTATCAACAACAATGATTCAAACAGTTGAAGATAGAGTACCAGT
ACTGATCACGCGCCAGAATGGCGAATCATGTGTACTGATGTCTCTCGATGAATATAACTCTCTCGAAGAGACGGCATACC
TAATGAGATCACCAAAAAATGCACGCAGACTTATGGACTCGATAGAAAGCCTAAAAGATGGAAAAGGGATGGAAAGGGAA
ATTATTAAGTGA
Antitoxin
Download Length: 134 a.a. Molecular weight: 14582.52 Da Isoelectric Point: 4.3588
>AT225105 WP_045194468.1 NZ_CP087197:3089434-3089835 [Pseudomonas sp. B21-012]
MQYPICIEWGDENTAIGIQVPDIPGAVTAGDTFEEAYTAAVEVAHIMLEEIASNGQAIPMPTTAATHRSNPDFADMGWGM
IEIDITPYLGKTEKVNVTLPGFVIQRIDRYVRDHNVKSRSSFLADAAMEKLGR
MQYPICIEWGDENTAIGIQVPDIPGAVTAGDTFEEAYTAAVEVAHIMLEEIASNGQAIPMPTTAATHRSNPDFADMGWGM
IEIDITPYLGKTEKVNVTLPGFVIQRIDRYVRDHNVKSRSSFLADAAMEKLGR
Download Length: 402 bp
>AT225105 NZ_CP120970:2671150-2671404 [Moellerella wisconsensis]
GTGAAGCTAACATGGTCTGCCGAAGCATGGGAAGATTACTTGTACTGGCAAGAAACGGACAGAAAAACCGTAAAAAAGAT
AAATGAGCTCATTAAGAATGCCAGTAGAACACCATTTGAAGGAAAAGGTAAACCTGAACCTCTGAAACACAATCTTGCTG
GGTTCTGGTCACGAAGAATTACGGCGGAACATCGATTAGTCTATGCCGTTAGTAATGATTCCTTGCTAATAGCATCATGT
CGTTATCACTACTGA
GTGAAGCTAACATGGTCTGCCGAAGCATGGGAAGATTACTTGTACTGGCAAGAAACGGACAGAAAAACCGTAAAAAAGAT
AAATGAGCTCATTAAGAATGCCAGTAGAACACCATTTGAAGGAAAAGGTAAACCTGAACCTCTGAAACACAATCTTGCTG
GGTTCTGGTCACGAAGAATTACGGCGGAACATCGATTAGTCTATGCCGTTAGTAATGATTCCTTGCTAATAGCATCATGT
CGTTATCACTACTGA
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2G8MXB6 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
No matching records found |