Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | TsdAT/- |
Location | 727141..727667 | Replicon | chromosome |
Accession | NZ_CP086654 | ||
Organism | Staphylococcus ratti strain CCM 9025 |
Toxin (Protein)
Gene name | TsdT | Uniprot ID | - |
Locus tag | LN051_RS03360 | Protein ID | WP_229293189.1 |
Coordinates | 727443..727667 (+) | Length | 75 a.a. |
Antitoxin (Protein)
Gene name | TsdA | Uniprot ID | - |
Locus tag | LN051_RS03355 | Protein ID | WP_229293188.1 |
Coordinates | 727141..727428 (+) | Length | 96 a.a. |
Genomic Context
Location: 722526..723164 (639 bp)
Type: Others
Protein ID: WP_229293184.1
Type: Others
Protein ID: WP_229293184.1
Location: 723253..724119 (867 bp)
Type: Others
Protein ID: WP_229293185.1
Type: Others
Protein ID: WP_229293185.1
Location: 727141..727428 (288 bp)
Type: Antitoxin
Protein ID: WP_229293188.1
Type: Antitoxin
Protein ID: WP_229293188.1
Location: 727443..727667 (225 bp)
Type: Toxin
Protein ID: WP_229293189.1
Type: Toxin
Protein ID: WP_229293189.1
Location: 727669..727872 (204 bp)
Type: Others
Protein ID: WP_229293190.1
Type: Others
Protein ID: WP_229293190.1
Location: 727982..730171 (2190 bp)
Type: Others
Protein ID: WP_229293191.1
Type: Others
Protein ID: WP_229293191.1
Location: 730256..730396 (141 bp)
Type: Others
Protein ID: WP_086375151.1
Type: Others
Protein ID: WP_086375151.1
Location: 724498..724698 (201 bp)
Type: Others
Protein ID: Protein_656
Type: Others
Protein ID: Protein_656
Location: 724870..725502 (633 bp)
Type: Others
Protein ID: WP_229293186.1
Type: Others
Protein ID: WP_229293186.1
Location: 725515..727005 (1491 bp)
Type: Others
Protein ID: WP_229293187.1
Type: Others
Protein ID: WP_229293187.1
Location: 730549..731763 (1215 bp)
Type: Others
Protein ID: WP_229293192.1
Type: Others
Protein ID: WP_229293192.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LN051_RS03330 (LN051_03330) | 722526..723164 | + | 639 | WP_229293184.1 | thiamine phosphate synthase | - |
LN051_RS03335 (LN051_03335) | 723253..724119 | + | 867 | WP_229293185.1 | membrane protein insertase YidC | - |
LN051_RS03340 (LN051_03340) | 724498..724698 | - | 201 | Protein_656 | transposase | - |
LN051_RS03345 (LN051_03345) | 724870..725502 | - | 633 | WP_229293186.1 | HD domain-containing protein | - |
LN051_RS03350 (LN051_03350) | 725515..727005 | - | 1491 | WP_229293187.1 | cardiolipin synthase | - |
LN051_RS03355 (LN051_03355) | 727141..727428 | + | 288 | WP_229293188.1 | copper-sensing transcriptional repressor CsoR | Antitoxin |
LN051_RS03360 (LN051_03360) | 727443..727667 | + | 225 | WP_229293189.1 | heavy metal-associated domain-containing protein | Toxin |
LN051_RS03365 (LN051_03365) | 727669..727872 | + | 204 | WP_229293190.1 | cation transporter | - |
LN051_RS03370 (LN051_03370) | 727982..730171 | + | 2190 | WP_229293191.1 | heavy metal translocating P-type ATPase | - |
LN051_RS03375 (LN051_03375) | 730256..730396 | + | 141 | WP_086375151.1 | Lmo0850 family protein | - |
LN051_RS03380 (LN051_03380) | 730549..731763 | - | 1215 | WP_229293192.1 | FtsW/RodA/SpoVE family cell cycle protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
No matching records found |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 75 a.a. Molecular weight: 8546.84 Da Isoelectric Point: 4.7063
>T224281 WP_229293189.1 NZ_CP086654:727443-727667 [Staphylococcus ratti]
MYKDIVFVEGIQSDLQKENLAQRLNQMIGVKEVTIDIERQSITLLYNTPVNLNTLEKEIYDTGYKVIRTEKGAI
MYKDIVFVEGIQSDLQKENLAQRLNQMIGVKEVTIDIERQSITLLYNTPVNLNTLEKEIYDTGYKVIRTEKGAI
Download Length: 225 bp
>T224281 NZ_CP119980:c2487278-2487175 [Salmonella enterica]
GGCAAGGCGATTTAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATAC
AGGAATCGTATTCGGTCTCTTTTT
GGCAAGGCGATTTAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATAC
AGGAATCGTATTCGGTCTCTTTTT
Antitoxin
Download Length: 96 a.a. Molecular weight: 11013.61 Da Isoelectric Point: 6.0845
>AT224281 WP_229293188.1 NZ_CP086654:727141-727428 [Staphylococcus ratti]
MEERAHHSVEIKKNLTSRLNRIEGQVRAINRMIDEDVYCDDVLTQIRATRSALNSVATKLLDYHMKGCITQKIEEGHETE
AMEELLVTFQKLLKD
MEERAHHSVEIKKNLTSRLNRIEGQVRAINRMIDEDVYCDDVLTQIRATRSALNSVATKLLDYHMKGCITQKIEEGHETE
AMEELLVTFQKLLKD
Download Length: 288 bp
>AT224281 NZ_CP119980:2487173-2487316 [Salmonella enterica]
ATAAAAAGAGACCGAATACGATTCCTGTATTCGGTCCAGGGAAATGGCTCTTGGGAGAGAGCCGTGCGCTAAAAGTTGGC
ATTAATGCAGGCTAAATCGCCTTGCCCTTTAAGAATAGATGACGACGCCAGGTTTTCCAGTTTG
ATAAAAAGAGACCGAATACGATTCCTGTATTCGGTCCAGGGAAATGGCTCTTGGGAGAGAGCCGTGCGCTAAAAGTTGGC
ATTAATGCAGGCTAAATCGCCTTGCCCTTTAAGAATAGATGACGACGCCAGGTTTTCCAGTTTG