Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | TsxAB/Xre(antitoxin) |
Location | 8292..8793 | Replicon | plasmid pEc-050-T0_5 |
Accession | NZ_CP086515 | ||
Organism | Escherichia coli strain Ec-050-T0 |
Toxin (Protein)
Gene name | TsxA | Uniprot ID | Q9F571 |
Locus tag | LNN50_RS25580 | Protein ID | WP_000702246.1 |
Coordinates | 8292..8552 (+) | Length | 87 a.a. |
Antitoxin (Protein)
Gene name | TsxB | Uniprot ID | - |
Locus tag | LNN50_RS25585 | Protein ID | WP_001132407.1 |
Coordinates | 8542..8793 (+) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LNN50_RS25535 (LNN50_25540) | 3826..3978 | + | 153 | WP_001414491.1 | DUF5431 family protein | - |
LNN50_RS25540 (LNN50_25545) | 3923..4045 | + | 123 | WP_223685802.1 | Hok/Gef family protein | - |
LNN50_RS25545 (LNN50_25550) | 4195..4791 | + | 597 | WP_000125166.1 | ProQ/FINO family protein | - |
LNN50_RS25550 (LNN50_25555) | 4809..5093 | - | 285 | WP_001162371.1 | hypothetical protein | - |
LNN50_RS25555 (LNN50_25560) | 5172..5837 | - | 666 | WP_000532148.1 | division plane positioning ATPase MipZ | - |
LNN50_RS25560 (LNN50_25565) | 6435..6764 | + | 330 | WP_000855118.1 | hypothetical protein | - |
LNN50_RS25565 (LNN50_25570) | 7345..7668 | + | 324 | WP_000427402.1 | hypothetical protein | - |
LNN50_RS25570 (LNN50_25575) | 7710..7919 | + | 210 | WP_000866037.1 | hypothetical protein | - |
LNN50_RS25575 (LNN50_25580) | 8017..8241 | + | 225 | WP_000814384.1 | hypothetical protein | - |
LNN50_RS25580 (LNN50_25585) | 8292..8552 | + | 261 | WP_000702246.1 | hypothetical protein | Toxin |
LNN50_RS25585 (LNN50_25590) | 8542..8793 | + | 252 | WP_001132407.1 | transcriptional regulator | Antitoxin |
LNN50_RS25590 (LNN50_25595) | 9343..9567 | + | 225 | WP_000814384.1 | hypothetical protein | - |
LNN50_RS25595 (LNN50_25600) | 9618..9878 | + | 261 | WP_000702246.1 | hypothetical protein | - |
LNN50_RS25600 (LNN50_25605) | 9868..10119 | + | 252 | WP_001132407.1 | transcriptional regulator | - |
LNN50_RS25605 (LNN50_25610) | 10669..10947 | + | 279 | WP_000545937.1 | hypothetical protein | - |
LNN50_RS25610 (LNN50_25615) | 11367..11633 | + | 267 | WP_000681608.1 | type II toxin-antitoxin system HicB family antitoxin | - |
LNN50_RS25615 (LNN50_25620) | 11740..12159 | - | 420 | WP_242879860.1 | hypothetical protein | - |
LNN50_RS25620 (LNN50_25625) | 12456..12638 | + | 183 | WP_000833470.1 | type II toxin-antitoxin system HicA family toxin | - |
LNN50_RS25625 (LNN50_25630) | 12663..13100 | + | 438 | WP_000466318.1 | type II toxin-antitoxin system HicB family antitoxin | - |
LNN50_RS25630 (LNN50_25635) | 13231..13557 | - | 327 | WP_000206697.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Mobilizable plasmid | - | - | 1..61289 | 61289 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 87 a.a. Molecular weight: 9891.42 Da Isoelectric Point: 10.0665
>T223659 WP_000702246.1 NZ_CP086515:8292-8552 [Escherichia coli]
MKIRKGDRQYYLNKEGDTFHLVKRVKTFSKSATLGKTKATVKTVADLVFHEKAFDTIDFASDGLRENDKEIIFMMIQEMS
EGKNAK
MKIRKGDRQYYLNKEGDTFHLVKRVKTFSKSATLGKTKATVKTVADLVFHEKAFDTIDFASDGLRENDKEIIFMMIQEMS
EGKNAK
Download Length: 261 bp
>T223659 NZ_CP119120:c2044546-2044439 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGTGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGTGTAACCGGAAGTAA
Antitoxin
Download Length: 84 a.a. Molecular weight: 9404.77 Da Isoelectric Point: 9.8120
>AT223659 WP_001132407.1 NZ_CP086515:8542-8793 [Escherichia coli]
MPNENTPENIKRLRQKIGLTQKECAEIFSMSPRTWRRKEEPVGTASGTALTPVEFKFLLLLAGEHPDYVLCKRNKKNSDS
GSN
MPNENTPENIKRLRQKIGLTQKECAEIFSMSPRTWRRKEEPVGTASGTALTPVEFKFLLLLAGEHPDYVLCKRNKKNSDS
GSN
Download Length: 252 bp
>AT223659 NZ_CP119120:2044599-2044660 [Escherichia coli]
TGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT
TGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|