Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC(toxin) |
| Location | 3281979..3282622 | Replicon | chromosome |
| Accession | NZ_CP086111 | ||
| Organism | Skermanella rosea strain KEMB 2255-458 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | JL101_RS15215 | Protein ID | WP_203100463.1 |
| Coordinates | 3282233..3282622 (+) | Length | 130 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | JL101_RS15210 | Protein ID | WP_203100462.1 |
| Coordinates | 3281979..3282233 (+) | Length | 85 a.a. |
Genomic Context
Location: 3277186..3278004 (819 bp)
Type: Others
Protein ID: WP_203100460.1
Type: Others
Protein ID: WP_203100460.1
Location: 3278004..3279224 (1221 bp)
Type: Others
Protein ID: WP_203100632.1
Type: Others
Protein ID: WP_203100632.1
Location: 3279813..3281891 (2079 bp)
Type: Others
Protein ID: WP_203100461.1
Type: Others
Protein ID: WP_203100461.1
Location: 3281979..3282233 (255 bp)
Type: Antitoxin
Protein ID: WP_203100462.1
Type: Antitoxin
Protein ID: WP_203100462.1
Location: 3282233..3282622 (390 bp)
Type: Toxin
Protein ID: WP_203100463.1
Type: Toxin
Protein ID: WP_203100463.1
Location: 3279345..3279668 (324 bp)
Type: Others
Protein ID: WP_228434848.1
Type: Others
Protein ID: WP_228434848.1
Location: 3282683..3283831 (1149 bp)
Type: Others
Protein ID: WP_203100464.1
Type: Others
Protein ID: WP_203100464.1
Location: 3283828..3284805 (978 bp)
Type: Others
Protein ID: WP_203100465.1
Type: Others
Protein ID: WP_203100465.1
Location: 3284816..3285640 (825 bp)
Type: Others
Protein ID: WP_202683445.1
Type: Others
Protein ID: WP_202683445.1
Location: 3285753..3285941 (189 bp)
Type: Others
Protein ID: WP_203100466.1
Type: Others
Protein ID: WP_203100466.1
Location: 3285951..3286214 (264 bp)
Type: Others
Protein ID: WP_201081429.1
Type: Others
Protein ID: WP_201081429.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JL101_RS15190 (JL101_015230) | 3277186..3278004 | + | 819 | WP_203100460.1 | putative photosynthetic complex assembly protein PuhE | - |
| JL101_RS15195 (JL101_015235) | 3278004..3279224 | + | 1221 | WP_203100632.1 | 5-aminolevulinate synthase | - |
| JL101_RS15200 (JL101_015240) | 3279345..3279668 | - | 324 | WP_228434848.1 | GxxExxY protein | - |
| JL101_RS15205 (JL101_015245) | 3279813..3281891 | + | 2079 | WP_203100461.1 | prolyl oligopeptidase family serine peptidase | - |
| JL101_RS15210 (JL101_015250) | 3281979..3282233 | + | 255 | WP_203100462.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| JL101_RS15215 (JL101_015255) | 3282233..3282622 | + | 390 | WP_203100463.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| JL101_RS15220 (JL101_015260) | 3282683..3283831 | - | 1149 | WP_203100464.1 | photosynthetic reaction center cytochrome PufC | - |
| JL101_RS15225 (JL101_015265) | 3283828..3284805 | - | 978 | WP_203100465.1 | photosynthetic reaction center subunit M | - |
| JL101_RS15230 (JL101_015270) | 3284816..3285640 | - | 825 | WP_202683445.1 | photosynthetic reaction center subunit L | - |
| JL101_RS15235 (JL101_015275) | 3285753..3285941 | - | 189 | WP_203100466.1 | light-harvesting antenna LH1, alpha subunit | - |
| JL101_RS15240 (JL101_015280) | 3285951..3286214 | - | 264 | WP_201081429.1 | light-harvesting antenna LH1, beta subunit | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| No matching records found | |||||||
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 130 a.a. Molecular weight: 14114.22 Da Isoelectric Point: 5.9081
>T222537 WP_203100463.1 NZ_CP086111:3282233-3282622 [Skermanella rosea]
MVIDTSAILAVLLGEPEAARISEEIGLGTPRLLSAANLLEASMVIETRKGEAAGRELDLFLYRARIEIVPVDQEQAEIAR
IAWRRYGKGRHPAGLNYGDCFAYALAKSRNAPLLFKGNDFAKTDIGQLN
MVIDTSAILAVLLGEPEAARISEEIGLGTPRLLSAANLLEASMVIETRKGEAAGRELDLFLYRARIEIVPVDQEQAEIAR
IAWRRYGKGRHPAGLNYGDCFAYALAKSRNAPLLFKGNDFAKTDIGQLN
Download Length: 390 bp
>T222537 NZ_CP117960:580814-580921 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 85 a.a. Molecular weight: 9333.54 Da Isoelectric Point: 4.8723
>AT222537 WP_203100462.1 NZ_CP086111:3281979-3282233 [Skermanella rosea]
MPLNIKDPSTEKIVRELAAVTGEAVTTAVRKAAEERLQRVRNDRFGNRLADELMEIGARCSALPDLDTRSADEILGYDEH
GLPR
MPLNIKDPSTEKIVRELAAVTGEAVTTAVRKAAEERLQRVRNDRFGNRLADELMEIGARCSALPDLDTRSADEILGYDEH
GLPR
Download Length: 255 bp
>AT222537 NZ_CP117960:c580767-580701 [Escherichia coli]
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT