Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | phd-doc/Doc-RelB |
| Location | 4558310..4558896 | Replicon | chromosome |
| Accession | NZ_CP085816 | ||
| Organism | Salmonella enterica subsp. enterica serovar Enteritidis strain Slowpoke | ||
Toxin (Protein)
| Gene name | doc | Uniprot ID | A0A3V9X0E4 |
| Locus tag | LJF68_RS22210 | Protein ID | WP_000174964.1 |
| Coordinates | 4558528..4558896 (+) | Length | 123 a.a. |
Antitoxin (Protein)
| Gene name | phd | Uniprot ID | V7IU48 |
| Locus tag | LJF68_RS22205 | Protein ID | WP_001522145.1 |
| Coordinates | 4558310..4558531 (+) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LJF68_RS22180 (4553331) | 4553331..4554440 | + | 1110 | WP_000822978.1 | high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK | - |
| LJF68_RS22185 (4554500) | 4554500..4555426 | + | 927 | WP_000003007.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
| LJF68_RS22190 (4555423) | 4555423..4556700 | + | 1278 | WP_000803764.1 | branched chain amino acid ABC transporter permease LivM | - |
| LJF68_RS22195 (4556697) | 4556697..4557464 | + | 768 | WP_000082080.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
| LJF68_RS22200 (4557466) | 4557466..4558179 | + | 714 | WP_000416114.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF | - |
| LJF68_RS22205 (4558310) | 4558310..4558531 | + | 222 | WP_001522145.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| LJF68_RS22210 (4558528) | 4558528..4558896 | + | 369 | WP_000174964.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
| LJF68_RS22215 (4559155) | 4559155..4560471 | + | 1317 | WP_000624755.1 | sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB | - |
| LJF68_RS22220 (4560576) | 4560576..4561463 | + | 888 | WP_000099303.1 | sn-glycerol-3-phosphate ABC transporter permease UgpA | - |
| LJF68_RS22225 (4561460) | 4561460..4562305 | + | 846 | WP_000572196.1 | sn-glycerol-3-phosphate ABC transporter permease UgpE | - |
| LJF68_RS22230 (4562307) | 4562307..4563377 | + | 1071 | WP_000907840.1 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 4555423..4564114 | 8691 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 123 a.a. Molecular weight: 13601.91 Da Isoelectric Point: 6.7252
>T221902 WP_000174964.1 NZ_CP085816:4558528-4558896 [Salmonella enterica subsp. enterica serovar Enteritidis]
MTLQLISAEEIIQFHDRLLRVTPGVTGMPDPGRAEALMYRVLNQIEYEGVTDVWLLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGISLAANPDFVDMTVDAAAGRLTLEQIVVRLRA
MTLQLISAEEIIQFHDRLLRVTPGVTGMPDPGRAEALMYRVLNQIEYEGVTDVWLLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGISLAANPDFVDMTVDAAAGRLTLEQIVVRLRA
Download Length: 369 bp
>T221902 NZ_CP117620:c3528713-3528561 [Escherichia albertii]
ATGCTAACAAAATATGCCCTTGTGGCAATCATAGTGCTGTGTTGTACAGTGCTGGGATTCACGCTGATGGTAGGCGACTC
GTTGTGTGAGTTGAGTATCAGAGAACGTGGTATGGAGTTTAAGGCAGTTCTCGCTTACGAATCGAAGAAGTAG
ATGCTAACAAAATATGCCCTTGTGGCAATCATAGTGCTGTGTTGTACAGTGCTGGGATTCACGCTGATGGTAGGCGACTC
GTTGTGTGAGTTGAGTATCAGAGAACGTGGTATGGAGTTTAAGGCAGTTCTCGCTTACGAATCGAAGAAGTAG
Antitoxin
Download Length: 74 a.a. Molecular weight: 8166.17 Da Isoelectric Point: 5.0775
>AT221902 WP_001522145.1 NZ_CP085816:4558310-4558531 [Salmonella enterica subsp. enterica serovar Enteritidis]
MRTVNYSEARQNLAEVLESAVTAGPVTITRRGHKSAVIISAEEFERYQTARMDDEFAAIMAVHGNELRELADK
MRTVNYSEARQNLAEVLESAVTAGPVTITRRGHKSAVIISAEEFERYQTARMDDEFAAIMAVHGNELRELADK
Download Length: 222 bp
>AT221902 NZ_CP117620:3528755-3528807 [Escherichia albertii]
TTAGGTTCGAACGCTGGCCTCAGGTTGATAGAAATATCGCCTGGGGCTTTTGT
TTAGGTTCGAACGCTGGCCTCAGGTTGATAGAAATATCGCCTGGGGCTTTTGT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|