Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | phd-doc/Doc-RelB |
| Location | 4099190..4099776 | Replicon | chromosome |
| Accession | NZ_CP085806 | ||
| Organism | Salmonella enterica subsp. enterica serovar Enteritidis strain Marill | ||
Toxin (Protein)
| Gene name | doc | Uniprot ID | A0A3V9X0E4 |
| Locus tag | LJF46_RS20110 | Protein ID | WP_000174964.1 |
| Coordinates | 4099190..4099558 (-) | Length | 123 a.a. |
Antitoxin (Protein)
| Gene name | phd | Uniprot ID | V7IU48 |
| Locus tag | LJF46_RS20115 | Protein ID | WP_001522145.1 |
| Coordinates | 4099555..4099776 (-) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LJF46_RS20090 (4094709) | 4094709..4095779 | - | 1071 | WP_000907840.1 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | - |
| LJF46_RS20095 (4095781) | 4095781..4096626 | - | 846 | WP_000572196.1 | sn-glycerol-3-phosphate ABC transporter permease UgpE | - |
| LJF46_RS20100 (4096623) | 4096623..4097510 | - | 888 | WP_000099303.1 | sn-glycerol-3-phosphate ABC transporter permease UgpA | - |
| LJF46_RS20105 (4097615) | 4097615..4098931 | - | 1317 | WP_000624755.1 | sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB | - |
| LJF46_RS20110 (4099190) | 4099190..4099558 | - | 369 | WP_000174964.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
| LJF46_RS20115 (4099555) | 4099555..4099776 | - | 222 | WP_001522145.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| LJF46_RS20120 (4099907) | 4099907..4100620 | - | 714 | WP_000416114.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF | - |
| LJF46_RS20125 (4100622) | 4100622..4101389 | - | 768 | WP_000082080.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
| LJF46_RS20130 (4101386) | 4101386..4102663 | - | 1278 | WP_000803764.1 | branched chain amino acid ABC transporter permease LivM | - |
| LJF46_RS20135 (4102660) | 4102660..4103586 | - | 927 | WP_000003007.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
| LJF46_RS20140 (4103646) | 4103646..4104755 | - | 1110 | WP_000822978.1 | high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 4093972..4109996 | 16024 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 123 a.a. Molecular weight: 13601.91 Da Isoelectric Point: 6.7252
>T221690 WP_000174964.1 NZ_CP085806:c4099558-4099190 [Salmonella enterica subsp. enterica serovar Enteritidis]
MTLQLISAEEIIQFHDRLLRVTPGVTGMPDPGRAEALMYRVLNQIEYEGVTDVWLLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGISLAANPDFVDMTVDAAAGRLTLEQIVVRLRA
MTLQLISAEEIIQFHDRLLRVTPGVTGMPDPGRAEALMYRVLNQIEYEGVTDVWLLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGISLAANPDFVDMTVDAAAGRLTLEQIVVRLRA
Download Length: 369 bp
>T221690 NZ_CP117568:c2736705-2736553 [Escherichia albertii]
ATGCCGCAGAAATATAGATTGCTTTCTTTAATAGTGATTTGTTTCACGCTTTTATTTTTCACCTGGATGATAAGAGATTC
ACTGTGTGAATTGCATATTAAACAGGGGAGTTATGAGCTGGCGGCGTTTTTAGCCTGCAATTTGAAAGAGTAA
ATGCCGCAGAAATATAGATTGCTTTCTTTAATAGTGATTTGTTTCACGCTTTTATTTTTCACCTGGATGATAAGAGATTC
ACTGTGTGAATTGCATATTAAACAGGGGAGTTATGAGCTGGCGGCGTTTTTAGCCTGCAATTTGAAAGAGTAA
Antitoxin
Download Length: 74 a.a. Molecular weight: 8166.17 Da Isoelectric Point: 5.0775
>AT221690 WP_001522145.1 NZ_CP085806:c4099776-4099555 [Salmonella enterica subsp. enterica serovar Enteritidis]
MRTVNYSEARQNLAEVLESAVTAGPVTITRRGHKSAVIISAEEFERYQTARMDDEFAAIMAVHGNELRELADK
MRTVNYSEARQNLAEVLESAVTAGPVTITRRGHKSAVIISAEEFERYQTARMDDEFAAIMAVHGNELRELADK
Download Length: 222 bp
>AT221690 NZ_CP117568:2736756-2736810 [Escherichia albertii]
GTTCAGGCATAGGGTAGCCTCACTTTGATTTATAGTCAGGTGGGGCTTTTCTCTG
GTTCAGGCATAGGGTAGCCTCACTTTGATTTATAGTCAGGTGGGGCTTTTCTCTG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|