Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | hicAB/- |
Location | 6094..6680 | Replicon | plasmid unnamed2 |
Accession | NZ_CP084760 | ||
Organism | UNVERIFIED_ORG: Shinella sp. XGS7 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | - |
Locus tag | LHJ69_RS24180 | Protein ID | WP_226882638.1 |
Coordinates | 6094..6354 (+) | Length | 87 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | LHJ69_RS24185 | Protein ID | WP_206366716.1 |
Coordinates | 6351..6680 (+) | Length | 110 a.a. |
Genomic Context
Location: 1219..1458 (240 bp)
Type: Others
Protein ID: WP_249225879.1
Type: Others
Protein ID: WP_249225879.1
Location: 2952..3686 (735 bp)
Type: Others
Protein ID: WP_226882634.1
Type: Others
Protein ID: WP_226882634.1
Location: 3683..4018 (336 bp)
Type: Others
Protein ID: WP_226882635.1
Type: Others
Protein ID: WP_226882635.1
Location: 4097..5317 (1221 bp)
Type: Others
Protein ID: WP_226882636.1
Type: Others
Protein ID: WP_226882636.1
Location: 5391..5558 (168 bp)
Type: Others
Protein ID: WP_226882637.1
Type: Others
Protein ID: WP_226882637.1
Location: 6094..6354 (261 bp)
Type: Toxin
Protein ID: WP_226882638.1
Type: Toxin
Protein ID: WP_226882638.1
Location: 6351..6680 (330 bp)
Type: Antitoxin
Protein ID: WP_206366716.1
Type: Antitoxin
Protein ID: WP_206366716.1
Location: 6683..6898 (216 bp)
Type: Others
Protein ID: WP_226882639.1
Type: Others
Protein ID: WP_226882639.1
Location: 7159..7719 (561 bp)
Type: Others
Protein ID: WP_226882640.1
Type: Others
Protein ID: WP_226882640.1
Location: 8526..9473 (948 bp)
Type: Others
Protein ID: WP_226882642.1
Type: Others
Protein ID: WP_226882642.1
Location: 10118..10744 (627 bp)
Type: Others
Protein ID: WP_024899726.1
Type: Others
Protein ID: WP_024899726.1
Location: 2122..2544 (423 bp)
Type: Others
Protein ID: WP_226882633.1
Type: Others
Protein ID: WP_226882633.1
Location: 7991..8317 (327 bp)
Type: Others
Protein ID: WP_226882641.1
Type: Others
Protein ID: WP_226882641.1
Location: 9518..9910 (393 bp)
Type: Others
Protein ID: WP_024899725.1
Type: Others
Protein ID: WP_024899725.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LHJ69_RS24145 (LHJ69_24135) | 1219..1458 | + | 240 | WP_249225879.1 | DUF3768 domain-containing protein | - |
LHJ69_RS24155 (LHJ69_24145) | 2122..2544 | - | 423 | WP_226882633.1 | hypothetical protein | - |
LHJ69_RS24160 (LHJ69_24150) | 2952..3686 | + | 735 | WP_226882634.1 | ParA family protein | - |
LHJ69_RS24165 (LHJ69_24155) | 3683..4018 | + | 336 | WP_226882635.1 | hypothetical protein | - |
LHJ69_RS24170 (LHJ69_24160) | 4097..5317 | + | 1221 | WP_226882636.1 | replication initiator protein A | - |
LHJ69_RS24175 (LHJ69_24165) | 5391..5558 | + | 168 | WP_226882637.1 | hypothetical protein | - |
LHJ69_RS24180 (LHJ69_24170) | 6094..6354 | + | 261 | WP_226882638.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
LHJ69_RS24185 (LHJ69_24175) | 6351..6680 | + | 330 | WP_206366716.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
LHJ69_RS24190 (LHJ69_24180) | 6683..6898 | + | 216 | WP_226882639.1 | hypothetical protein | - |
LHJ69_RS24195 (LHJ69_24185) | 7159..7719 | + | 561 | WP_226882640.1 | hypothetical protein | - |
LHJ69_RS24200 (LHJ69_24190) | 7991..8317 | - | 327 | WP_226882641.1 | hypothetical protein | - |
LHJ69_RS24205 (LHJ69_24195) | 8526..9473 | + | 948 | WP_226882642.1 | MobQ family relaxase | - |
LHJ69_RS24210 (LHJ69_24200) | 9518..9910 | - | 393 | WP_024899725.1 | hypothetical protein | - |
LHJ69_RS24215 (LHJ69_24205) | 10118..10744 | + | 627 | WP_024899726.1 | recombinase family protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..18961 | 18961 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 87 a.a. Molecular weight: 9574.03 Da Isoelectric Point: 9.3476
>T219288 WP_226882638.1 NZ_CP084760:6094-6354 [Shinella sp. XGS7]
MELSRKHQATLEAVFAEPVRASIPWRDIEAMLAACGAEITEGQGSRVRIALNGVRAVFHRPHPQKETDKGAVKSVRRFLL
EAEIQP
MELSRKHQATLEAVFAEPVRASIPWRDIEAMLAACGAEITEGQGSRVRIALNGVRAVFHRPHPQKETDKGAVKSVRRFLL
EAEIQP
Download Length: 261 bp
>T219288 NZ_CP116242:c5719-5567 [Escherichia coli]
ATGCCACAGCGAACGTTTTTAATGATGTTAATCGTCATCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGGACTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA
ATGCCACAGCGAACGTTTTTAATGATGTTAATCGTCATCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGGACTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA
Antitoxin
Download Length: 110 a.a. Molecular weight: 12111.67 Da Isoelectric Point: 4.6207
>AT219288 WP_206366716.1 NZ_CP084760:6351-6680 [Shinella sp. XGS7]
MTMMHYKGYEAVVEFDEEAEIFHGEVINLRDVITFQGASAAELKQAFAESVEDYLAFCAERGEEPEKPFSGQFVVRTEPG
LHKALTVAARRAGVSLNKWVTSTLERAVG
MTMMHYKGYEAVVEFDEEAEIFHGEVINLRDVITFQGASAAELKQAFAESVEDYLAFCAERGEEPEKPFSGQFVVRTEPG
LHKALTVAARRAGVSLNKWVTSTLERAVG
Download Length: 330 bp
>AT219288 NZ_CP116242:5774-5831 [Escherichia coli]
GCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
GCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT