Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | relBE/RHH(antitoxin) |
Location | 3728776..3729329 | Replicon | chromosome |
Accession | NC_008786 | ||
Organism | Verminephrobacter eiseniae EF01-2 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | VEIS_RS16275 | Protein ID | WP_011811071.1 |
Coordinates | 3728776..3729069 (-) | Length | 98 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A1WN73 |
Locus tag | VEIS_RS16280 | Protein ID | WP_011811072.1 |
Coordinates | 3729057..3729329 (-) | Length | 91 a.a. |
Genomic Context
Location: 3725209..3725472 (264 bp)
Type: Others
Protein ID: WP_041950935.1
Type: Others
Protein ID: WP_041950935.1
Location: 3725459..3725761 (303 bp)
Type: Others
Protein ID: WP_011811064.1
Type: Others
Protein ID: WP_011811064.1
Location: 3726051..3726560 (510 bp)
Type: Others
Protein ID: Protein_3445
Type: Others
Protein ID: Protein_3445
Location: 3726595..3726976 (382 bp)
Type: Others
Protein ID: Protein_3446
Type: Others
Protein ID: Protein_3446
Location: 3727050..3727382 (333 bp)
Type: Others
Protein ID: WP_083758754.1
Type: Others
Protein ID: WP_083758754.1
Location: 3727379..3727690 (312 bp)
Type: Others
Protein ID: WP_011811068.1
Type: Others
Protein ID: WP_011811068.1
Location: 3729520..3730227 (708 bp)
Type: Others
Protein ID: Protein_3455
Type: Others
Protein ID: Protein_3455
Location: 3730234..3730425 (192 bp)
Type: Others
Protein ID: WP_198138058.1
Type: Others
Protein ID: WP_198138058.1
Location: 3730493..3731124 (632 bp)
Type: Others
Protein ID: Protein_3457
Type: Others
Protein ID: Protein_3457
Location: 3731117..3731446 (330 bp)
Type: Others
Protein ID: WP_011811074.1
Type: Others
Protein ID: WP_011811074.1
Location: 3731895..3732440 (546 bp)
Type: Others
Protein ID: Protein_3460
Type: Others
Protein ID: Protein_3460
Location: 3732747..3733808 (1062 bp)
Type: Others
Protein ID: WP_011811077.1
Type: Others
Protein ID: WP_011811077.1
Location: 3723820..3724167 (348 bp)
Type: Others
Protein ID: WP_011811061.1
Type: Others
Protein ID: WP_011811061.1
Location: 3724133..3724529 (397 bp)
Type: Others
Protein ID: Protein_3440
Type: Others
Protein ID: Protein_3440
Location: 3724631..3724795 (165 bp)
Type: Others
Protein ID: Protein_3441
Type: Others
Protein ID: Protein_3441
Location: 3724796..3724945 (150 bp)
Type: Others
Protein ID: WP_086014399.1
Type: Others
Protein ID: WP_086014399.1
Location: 3728049..3728234 (186 bp)
Type: Others
Protein ID: Protein_3449
Type: Others
Protein ID: Protein_3449
Location: 3728217..3728363 (147 bp)
Type: Others
Protein ID: Protein_3450
Type: Others
Protein ID: Protein_3450
Location: 3728391..3728606 (216 bp)
Type: Others
Protein ID: Protein_3451
Type: Others
Protein ID: Protein_3451
Location: 3728603..3728776 (174 bp)
Type: Others
Protein ID: WP_011811070.1
Type: Others
Protein ID: WP_011811070.1
Location: 3728776..3729069 (294 bp)
Type: Toxin
Protein ID: WP_011811071.1
Type: Toxin
Protein ID: WP_011811071.1
Location: 3729057..3729329 (273 bp)
Type: Antitoxin
Protein ID: WP_011811072.1
Type: Antitoxin
Protein ID: WP_011811072.1
Location: 3731558..3731893 (336 bp)
Type: Others
Protein ID: Protein_3459
Type: Others
Protein ID: Protein_3459
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
VEIS_RS16230 | 3723820..3724167 | - | 348 | WP_011811061.1 | helix-turn-helix domain-containing protein | - |
VEIS_RS26600 | 3724133..3724529 | - | 397 | Protein_3440 | type II toxin-antitoxin system RelE/ParE family toxin | - |
VEIS_RS27800 | 3724631..3724795 | - | 165 | Protein_3441 | Hin recombinase | - |
VEIS_RS27805 | 3724796..3724945 | - | 150 | WP_086014399.1 | replication initiation protein | - |
VEIS_RS16240 | 3725209..3725472 | + | 264 | WP_041950935.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | - |
VEIS_RS16245 | 3725459..3725761 | + | 303 | WP_011811064.1 | type II toxin-antitoxin system YafQ family toxin | - |
VEIS_RS16250 | 3726051..3726560 | + | 510 | Protein_3445 | Tn3 family transposase | - |
VEIS_RS16255 | 3726595..3726976 | + | 382 | Protein_3446 | hypothetical protein | - |
VEIS_RS16260 | 3727050..3727382 | + | 333 | WP_083758754.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
VEIS_RS16265 | 3727379..3727690 | + | 312 | WP_011811068.1 | putative addiction module antidote protein | - |
VEIS_RS29795 | 3728049..3728234 | - | 186 | Protein_3449 | hypothetical protein | - |
VEIS_RS29800 | 3728217..3728363 | - | 147 | Protein_3450 | addiction module antidote protein | - |
VEIS_RS26615 | 3728391..3728606 | - | 216 | Protein_3451 | transcriptional regulator | - |
VEIS_RS28900 | 3728603..3728776 | - | 174 | WP_011811070.1 | hypothetical protein | - |
VEIS_RS16275 | 3728776..3729069 | - | 294 | WP_011811071.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
VEIS_RS16280 | 3729057..3729329 | - | 273 | WP_011811072.1 | CopG family ribbon-helix-helix protein | Antitoxin |
VEIS_RS16285 | 3729520..3730227 | + | 708 | Protein_3455 | recombinase family protein | - |
VEIS_RS29805 | 3730234..3730425 | + | 192 | WP_198138058.1 | hypothetical protein | - |
VEIS_RS16290 | 3730493..3731124 | + | 632 | Protein_3457 | ParA family protein | - |
VEIS_RS16295 | 3731117..3731446 | + | 330 | WP_011811074.1 | hypothetical protein | - |
VEIS_RS16300 | 3731558..3731893 | - | 336 | Protein_3459 | integrase | - |
VEIS_RS16305 | 3731895..3732440 | + | 546 | Protein_3460 | site-specific integrase | - |
VEIS_RS16310 | 3732747..3733808 | + | 1062 | WP_011811077.1 | IS630 family transposase | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 3708468..3738897 | 30429 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 98 a.a. Molecular weight: 10702.20 Da Isoelectric Point: 5.6218
>T21917 WP_011811071.1 NC_008786:c3729069-3728776 [Verminephrobacter eiseniae EF01-2]
VPQVIVTEGAAEGLERCRRFLAVKAPDAARRAGQAIERQFLLLKTAPDIGPPFPETPELRELVIAFGDSGYVALYHHEPA
DDAVYVLAFRHQKEAGY
VPQVIVTEGAAEGLERCRRFLAVKAPDAARRAGQAIERQFLLLKTAPDIGPPFPETPELRELVIAFGDSGYVALYHHEPA
DDAVYVLAFRHQKEAGY
Download Length: 294 bp
>T21917 NC_008786:c3729069-3728776 [Verminephrobacter eiseniae EF01-2]
GTGCCACAAGTAATCGTCACCGAAGGCGCGGCGGAGGGCTTGGAACGATGCCGGCGGTTCCTGGCCGTCAAGGCACCGGA
CGCCGCCAGGCGTGCCGGCCAGGCCATCGAGCGGCAATTCCTGCTGCTGAAGACGGCCCCCGACATTGGCCCGCCGTTCC
CTGAAACGCCCGAGCTGCGCGAGCTGGTGATTGCCTTCGGGGATTCCGGCTACGTGGCCCTGTACCACCACGAACCGGCC
GACGATGCTGTGTATGTTCTGGCCTTCCGGCACCAGAAAGAGGCGGGCTACTAA
GTGCCACAAGTAATCGTCACCGAAGGCGCGGCGGAGGGCTTGGAACGATGCCGGCGGTTCCTGGCCGTCAAGGCACCGGA
CGCCGCCAGGCGTGCCGGCCAGGCCATCGAGCGGCAATTCCTGCTGCTGAAGACGGCCCCCGACATTGGCCCGCCGTTCC
CTGAAACGCCCGAGCTGCGCGAGCTGGTGATTGCCTTCGGGGATTCCGGCTACGTGGCCCTGTACCACCACGAACCGGCC
GACGATGCTGTGTATGTTCTGGCCTTCCGGCACCAGAAAGAGGCGGGCTACTAA
Antitoxin
Download Length: 91 a.a. Molecular weight: 10579.86 Da Isoelectric Point: 8.0869
>AT21917 WP_011811072.1 NC_008786:c3729329-3729057 [Verminephrobacter eiseniae EF01-2]
MSTSLKIDDTLKGRVQHLASQRRRSPHWIMLEAIQQYVEREEARESFKQEALASWAAYKETGRHLTGQEVRTWLNTWGTN
DERAVPECHK
MSTSLKIDDTLKGRVQHLASQRRRSPHWIMLEAIQQYVEREEARESFKQEALASWAAYKETGRHLTGQEVRTWLNTWGTN
DERAVPECHK
Download Length: 273 bp
>AT21917 NC_008786:c3729329-3729057 [Verminephrobacter eiseniae EF01-2]
ATGTCAACGTCTCTCAAGATCGACGATACGCTGAAAGGTCGCGTCCAGCACCTGGCCAGCCAGCGCCGGCGCTCACCCCA
CTGGATCATGCTCGAAGCGATCCAGCAGTACGTCGAGCGCGAAGAAGCCCGCGAGAGCTTCAAGCAGGAAGCCTTGGCAT
CCTGGGCGGCCTACAAGGAAACCGGCCGCCACCTGACCGGCCAGGAAGTTCGCACCTGGTTGAACACCTGGGGCACCAAT
GACGAAAGGGCGGTGCCTGAGTGCCACAAGTAA
ATGTCAACGTCTCTCAAGATCGACGATACGCTGAAAGGTCGCGTCCAGCACCTGGCCAGCCAGCGCCGGCGCTCACCCCA
CTGGATCATGCTCGAAGCGATCCAGCAGTACGTCGAGCGCGAAGAAGCCCGCGAGAGCTTCAAGCAGGAAGCCTTGGCAT
CCTGGGCGGCCTACAAGGAAACCGGCCGCCACCTGACCGGCCAGGAAGTTCGCACCTGGTTGAACACCTGGGGCACCAAT
GACGAAAGGGCGGTGCCTGAGTGCCACAAGTAA
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
No matching records found |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A1WN73 |