Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | FicTA/Fic(toxin) |
Location | 1568472..1568935 | Replicon | chromosome |
Accession | NC_008786 | ||
Organism | Verminephrobacter eiseniae EF01-2 |
Toxin (Protein)
Gene name | VbhT | Uniprot ID | - |
Locus tag | VEIS_RS29660 | Protein ID | WP_198137966.1 |
Coordinates | 1568472..1568750 (-) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | VbhA | Uniprot ID | A1WHR5 |
Locus tag | VEIS_RS06870 | Protein ID | WP_011809181.1 |
Coordinates | 1568747..1568935 (-) | Length | 63 a.a. |
Genomic Context
Location: 1567130..1567564 (435 bp)
Type: Others
Protein ID: Protein_1458
Type: Others
Protein ID: Protein_1458
Location: 1567562..1567894 (333 bp)
Type: Others
Protein ID: Protein_1459
Type: Others
Protein ID: Protein_1459
Location: 1571635..1572546 (912 bp)
Type: Others
Protein ID: WP_011809184.1
Type: Others
Protein ID: WP_011809184.1
Location: 1572599..1572925 (327 bp)
Type: Others
Protein ID: WP_011809185.1
Type: Others
Protein ID: WP_011809185.1
Location: 1572922..1573494 (573 bp)
Type: Others
Protein ID: WP_011809186.1
Type: Others
Protein ID: WP_011809186.1
Location: 1564478..1565035 (558 bp)
Type: Others
Protein ID: WP_011809175.1
Type: Others
Protein ID: WP_011809175.1
Location: 1565029..1565400 (372 bp)
Type: Others
Protein ID: WP_011809176.1
Type: Others
Protein ID: WP_011809176.1
Location: 1565397..1565723 (327 bp)
Type: Others
Protein ID: WP_011809177.1
Type: Others
Protein ID: WP_011809177.1
Location: 1565747..1566142 (396 bp)
Type: Others
Protein ID: WP_011809178.1
Type: Others
Protein ID: WP_011809178.1
Location: 1566306..1566683 (378 bp)
Type: Others
Protein ID: WP_011809179.1
Type: Others
Protein ID: WP_011809179.1
Location: 1566680..1566970 (291 bp)
Type: Others
Protein ID: WP_011809180.1
Type: Others
Protein ID: WP_011809180.1
Location: 1568142..1568414 (273 bp)
Type: Others
Protein ID: WP_198137964.1
Type: Others
Protein ID: WP_198137964.1
Location: 1568472..1568750 (279 bp)
Type: Toxin
Protein ID: WP_198137966.1
Type: Toxin
Protein ID: WP_198137966.1
Location: 1568747..1568935 (189 bp)
Type: Antitoxin
Protein ID: WP_011809181.1
Type: Antitoxin
Protein ID: WP_011809181.1
Location: 1569000..1569464 (465 bp)
Type: Others
Protein ID: WP_011809182.1
Type: Others
Protein ID: WP_011809182.1
Location: 1570003..1571357 (1355 bp)
Type: Others
Protein ID: Protein_1464
Type: Others
Protein ID: Protein_1464
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
VEIS_RS06830 | 1564478..1565035 | - | 558 | WP_011809175.1 | recombinase family protein | - |
VEIS_RS06835 | 1565029..1565400 | - | 372 | WP_011809176.1 | hypothetical protein | - |
VEIS_RS06840 | 1565397..1565723 | - | 327 | WP_011809177.1 | hypothetical protein | - |
VEIS_RS06845 | 1565747..1566142 | - | 396 | WP_011809178.1 | hypothetical protein | - |
VEIS_RS06850 | 1566306..1566683 | - | 378 | WP_011809179.1 | DUF86 domain-containing protein | - |
VEIS_RS06855 | 1566680..1566970 | - | 291 | WP_011809180.1 | nucleotidyltransferase | - |
VEIS_RS29645 | 1567130..1567564 | + | 435 | Protein_1458 | DUF4158 domain-containing protein | - |
VEIS_RS29650 | 1567562..1567894 | + | 333 | Protein_1459 | Tn3 family transposase | - |
VEIS_RS29655 | 1568142..1568414 | - | 273 | WP_198137964.1 | Fic family protein | - |
VEIS_RS29660 | 1568472..1568750 | - | 279 | WP_198137966.1 | Fic family protein | Toxin |
VEIS_RS06870 | 1568747..1568935 | - | 189 | WP_011809181.1 | antitoxin VbhA family protein | Antitoxin |
VEIS_RS06875 | 1569000..1569464 | - | 465 | WP_011809182.1 | hypothetical protein | - |
VEIS_RS06880 | 1570003..1571357 | - | 1355 | Protein_1464 | IS4 family transposase | - |
VEIS_RS06885 | 1571635..1572546 | + | 912 | WP_011809184.1 | hypothetical protein | - |
VEIS_RS06890 | 1572599..1572925 | + | 327 | WP_011809185.1 | type II toxin-antitoxin system PrlF family antitoxin | - |
VEIS_RS06895 | 1572922..1573494 | + | 573 | WP_011809186.1 | type II toxin-antitoxin system YhaV family toxin | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
No matching records found |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10411.85 Da Isoelectric Point: 9.5348
>T21915 WP_198137966.1 NC_008786:c1568750-1568472 [Verminephrobacter eiseniae EF01-2]
MKYAGDRGDPYLDSETGVLRNLLGIKEQGGLDKAESTLSFLRASELREQPVKGKFDLAHLQRIHKRLFGDVYDWAGQIRQ
VEISKGSTMFAR
MKYAGDRGDPYLDSETGVLRNLLGIKEQGGLDKAESTLSFLRASELREQPVKGKFDLAHLQRIHKRLFGDVYDWAGQIRQ
VEISKGSTMFAR
Download Length: 279 bp
>T21915 NC_008786:c1568750-1568472 [Verminephrobacter eiseniae EF01-2]
ATGAAATACGCCGGGGATCGCGGCGATCCTTACCTGGACAGCGAAACGGGTGTTCTCCGCAATCTCCTTGGAATCAAGGA
ACAGGGTGGACTCGATAAAGCCGAATCCACCCTTTCCTTTTTGCGGGCCAGCGAATTGCGCGAGCAGCCCGTTAAAGGCA
AATTCGATTTAGCGCACCTGCAGCGAATTCACAAGCGCCTTTTTGGCGACGTGTACGACTGGGCGGGCCAAATCCGCCAG
GTCGAAATCTCGAAAGGCAGCACTATGTTTGCCCGGTAG
ATGAAATACGCCGGGGATCGCGGCGATCCTTACCTGGACAGCGAAACGGGTGTTCTCCGCAATCTCCTTGGAATCAAGGA
ACAGGGTGGACTCGATAAAGCCGAATCCACCCTTTCCTTTTTGCGGGCCAGCGAATTGCGCGAGCAGCCCGTTAAAGGCA
AATTCGATTTAGCGCACCTGCAGCGAATTCACAAGCGCCTTTTTGGCGACGTGTACGACTGGGCGGGCCAAATCCGCCAG
GTCGAAATCTCGAAAGGCAGCACTATGTTTGCCCGGTAG
Antitoxin
Download Length: 63 a.a. Molecular weight: 6890.76 Da Isoelectric Point: 4.4982
>AT21915 WP_011809181.1 NC_008786:c1568935-1568747 [Verminephrobacter eiseniae EF01-2]
MISEQEQTERRAVVQSALASQRIEGLEPDAQAVADAERWARGEMAIGAAVDQYKARMRLEMA
MISEQEQTERRAVVQSALASQRIEGLEPDAQAVADAERWARGEMAIGAAVDQYKARMRLEMA
Download Length: 189 bp
>AT21915 NC_008786:c1568935-1568747 [Verminephrobacter eiseniae EF01-2]
ATGATCTCAGAGCAGGAACAAACCGAGCGCCGCGCCGTGGTGCAAAGCGCCCTTGCGAGCCAGCGCATCGAGGGCTTGGA
GCCTGATGCACAGGCCGTGGCCGACGCCGAACGCTGGGCGCGTGGCGAGATGGCCATCGGTGCCGCCGTGGACCAGTACA
AGGCGCGCATGCGGCTAGAAATGGCATGA
ATGATCTCAGAGCAGGAACAAACCGAGCGCCGCGCCGTGGTGCAAAGCGCCCTTGCGAGCCAGCGCATCGAGGGCTTGGA
GCCTGATGCACAGGCCGTGGCCGACGCCGAACGCTGGGCGCGTGGCGAGATGGCCATCGGTGCCGCCGTGGACCAGTACA
AGGCGCGCATGCGGCTAGAAATGGCATGA
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
No matching records found |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A1WHR5 |