Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 86625..87151 | Replicon | plasmid p1 |
Accession | NZ_CP083755 | ||
Organism | Serratia marcescens strain YL4 |
Toxin (Protein)
Gene name | relE | Uniprot ID | S1EXL1 |
Locus tag | LBP97_RS25175 | Protein ID | WP_000323025.1 |
Coordinates | 86864..87151 (+) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | S1F6D3 |
Locus tag | LBP97_RS25170 | Protein ID | WP_000534858.1 |
Coordinates | 86625..86864 (+) | Length | 80 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LBP97_RS25150 (LBP97_25185) | 82953..84191 | + | 1239 | WP_000219087.1 | IS110-like element ISEsa2 family transposase | - |
LBP97_RS25155 (LBP97_25190) | 84667..85239 | + | 573 | WP_001515348.1 | cytochrome b/b6 domain-containing protein | - |
LBP97_RS25160 (LBP97_25195) | 85439..86362 | + | 924 | WP_000167917.1 | cation diffusion facilitator family transporter | - |
LBP97_RS25165 (LBP97_25200) | 86496..86600 | - | 105 | Protein_93 | protein YdfV | - |
LBP97_RS25170 (LBP97_25205) | 86625..86864 | + | 240 | WP_000534858.1 | type II toxin-antitoxin system antitoxin RelB | Antitoxin |
LBP97_RS25175 (LBP97_25210) | 86864..87151 | + | 288 | WP_000323025.1 | type II toxin-antitoxin system mRNA interferase RelE | Toxin |
LBP97_RS25180 (LBP97_25220) | 87223..87381 | + | 159 | WP_001447866.1 | type I toxin-antitoxin system Hok family toxin | - |
LBP97_RS25185 (LBP97_25225) | 87990..88310 | - | 321 | WP_000332796.1 | hypothetical protein | - |
LBP97_RS25190 (LBP97_25230) | 88592..88795 | - | 204 | WP_001015183.1 | hypothetical protein | - |
LBP97_RS25195 (LBP97_25235) | 88842..89192 | - | 351 | WP_000743059.1 | hypothetical protein | - |
LBP97_RS25200 (LBP97_25240) | 89252..89854 | - | 603 | WP_012695474.1 | hypothetical protein | - |
LBP97_RS25205 (LBP97_25245) | 89950..90894 | - | 945 | WP_000778029.1 | DUF5417 domain-containing protein | - |
LBP97_RS25210 (LBP97_25250) | 91405..91581 | + | 177 | WP_001371930.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | mph(A) / tet(D) / mcr-9 / aph(6)-Id / aph(3'')-Ib / blaTEM-1B / fosA5 / sul1 / qacE / blaIMP-26 / dfrA19 / catA2 / blaSHV-12 | - | 1..316459 | 316459 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11225.22 Da Isoelectric Point: 10.1967
>T217262 WP_000323025.1 NZ_CP083755:86864-87151 [Serratia marcescens]
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
Download Length: 288 bp
>T217262 NZ_CP114128:1893649-1893804 [Escherichia coli]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAATCTGAGGAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAATCTGAGGAGTAA
Antitoxin
Download Length: 80 a.a. Molecular weight: 9071.48 Da Isoelectric Point: 4.5230
>AT217262 WP_000534858.1 NZ_CP083755:86625-86864 [Serratia marcescens]
MGSINLRIDDELKARSYAALEKMGVTPSEALRLMLEYIADNERLPFKQTLLSDEDAELVEIVKERLRNPKPVRVTLDEL
MGSINLRIDDELKARSYAALEKMGVTPSEALRLMLEYIADNERLPFKQTLLSDEDAELVEIVKERLRNPKPVRVTLDEL
Download Length: 240 bp
>AT217262 NZ_CP114128:c1893637-1893579 [Escherichia coli]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACGTGTGTAGAGCATAGATATGGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACGTGTGTAGAGCATAGATATGGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|