Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/Phd(antitoxin)
Location 2151166..2151713 Replicon chromosome
Accession NZ_CP083361
Organism Vibrio parahaemolyticus strain 20-082E4

Toxin (Protein)


Gene name relE Uniprot ID A0A347UR19
Locus tag K9N54_RS10480 Protein ID WP_025548916.1
Coordinates 2151166..2151468 (-) Length 101 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID U3A269
Locus tag K9N54_RS10485 Protein ID WP_005448240.1
Coordinates 2151456..2151713 (-) Length 86 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
K9N54_RS10435 (K9N54_10325) 2146422..2147024 - 603 WP_033904997.1 hypothetical protein -
K9N54_RS10440 (K9N54_10330) 2147202..2147468 - 267 WP_025793447.1 barstar family protein -
K9N54_RS10445 (K9N54_10335) 2147510..2147602 - 93 WP_080261757.1 DUF3265 domain-containing protein -
K9N54_RS10450 (K9N54_10340) 2147676..2147978 + 303 WP_025793446.1 hypothetical protein -
K9N54_RS10455 (K9N54_10345) 2148127..2148474 - 348 WP_025793445.1 DUF6404 family protein -
K9N54_RS10460 (K9N54_10350) 2148567..2148656 - 90 WP_077281693.1 DUF3265 domain-containing protein -
K9N54_RS10465 (K9N54_10355) 2148690..2149058 - 369 WP_224067034.1 GFA family protein -
K9N54_RS10470 (K9N54_10360) 2150448..2150732 + 285 WP_005497249.1 type II toxin-antitoxin system RelB/DinJ family antitoxin -
K9N54_RS10475 (K9N54_10365) 2150729..2151007 + 279 WP_025793444.1 type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family -
K9N54_RS10480 (K9N54_10370) 2151166..2151468 - 303 WP_025548916.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
K9N54_RS10485 (K9N54_10375) 2151456..2151713 - 258 WP_005448240.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
K9N54_RS10490 (K9N54_10380) 2151795..2151926 - 132 WP_080277536.1 DUF3265 domain-containing protein -
K9N54_RS10495 (K9N54_10385) 2153023..2153115 - 93 WP_140050476.1 DUF3265 domain-containing protein -
K9N54_RS10500 (K9N54_10390) 2153602..2153967 - 366 WP_025793443.1 hypothetical protein -
K9N54_RS10505 (K9N54_10395) 2154051..2154170 - 120 WP_080277534.1 DUF3265 domain-containing protein -
K9N54_RS10510 (K9N54_10400) 2154157..2154531 - 375 WP_025793442.1 hypothetical protein -
K9N54_RS10515 (K9N54_10405) 2154565..2154657 - 93 WP_080277533.1 DUF3265 domain-containing protein -
K9N54_RS10520 (K9N54_10410) 2154678..2155340 - 663 WP_025793441.1 hypothetical protein -
K9N54_RS10525 (K9N54_10415) 2155349..2155489 - 141 WP_148299773.1 DUF3265 domain-containing protein -
K9N54_RS10530 (K9N54_10420) 2155486..2155857 - 372 WP_025793440.1 RidA family protein -
K9N54_RS10535 (K9N54_10425) 2155971..2156690 - 720 WP_025793439.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 2041179..2166543 125364
- inside Integron - - 2090758..2165418 74660


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-69)


Sequences

Toxin        


Download         Length: 101 a.a.        Molecular weight: 11669.57 Da        Isoelectric Point: 5.1765

>T216311 WP_025548916.1 NZ_CP083361:c2151468-2151166 [Vibrio parahaemolyticus]
MAEIIWTEPALSDLNDIAEYIALENIVAAKQLVQTIFSKVERLQTFPESGRIPPELEHLSYREVVVNPCRVFYKQDGDKV
FILFVMRAERDLRKFLLSKQ

Download         Length: 303 bp

>T216311 NZ_CP113009:1572555-1572650 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG

Antitoxin


Download         Length: 86 a.a.        Molecular weight: 9606.10 Da        Isoelectric Point: 6.7269

>AT216311 WP_005448240.1 NZ_CP083361:c2151713-2151456 [Vibrio parahaemolyticus]
MKVELVTSLKRQATKILADLHDTKEPVLITEHGKPSAYLVDVDDYEFMQNRLAILEGIARGERALADGKVVSHDEAKDKM
SKWLK

Download         Length: 258 bp

>AT216311 NZ_CP113009:c1572737-1572678 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A347UR19

Antitoxin

Source ID Structure
AlphaFold DB A0A432DGX8

References